Project name: NPY_WT

Status: done

Started: 2026-06-01 18:43:14
Chain sequence(s) A: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[WARNING]    PDB-Info: The input structure is likely a peptide. Results may be inaccurate.         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:25)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/386560f7083e533/tmp/folded.pdb                (00:00:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)
Show buried residues

Minimal score value
-2.2259
Maximal score value
2.0519
Average score
-0.4778
Total score value
-17.1998

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Y A 1.2697
2 P A -0.0492
3 S A -0.5159
4 K A -1.7740
5 P A -0.8783
6 D A -1.9981
7 N A -1.2697
8 P A -0.4970
9 G A -0.8328
10 E A -2.2259
11 D A -2.1086
12 A A -0.2824
13 P A -0.3479
14 A A -0.2847
15 E A -1.9685
16 D A -1.2858
17 M A 0.5852
18 A A -0.3562
19 R A -1.7728
20 Y A 0.5818
21 Y A 1.4071
22 S A 0.0557
23 A A 0.2257
24 L A 0.9743
25 R A -1.6719
26 H A -1.1076
27 Y A 1.3426
28 I A 2.0519
29 N A -0.8384
30 L A 0.4479
31 I A 0.7492
32 T A -0.2055
33 R A -1.9878
34 Q A -1.7833
35 R A -1.8207
36 Y A 0.9721
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is likely a peptide. Results may be inaccurate. The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3159 3.0505 View CSV PDB
4.5 -0.3717 3.0505 View CSV PDB
5.0 -0.4355 3.0505 View CSV PDB
5.5 -0.4967 3.0505 View CSV PDB
6.0 -0.5495 3.0505 View CSV PDB
6.5 -0.5935 3.0505 View CSV PDB
7.0 -0.6285 3.0505 View CSV PDB
7.5 -0.6557 3.0505 View CSV PDB
8.0 -0.6767 3.0504 View CSV PDB
8.5 -0.6902 3.0501 View CSV PDB
9.0 -0.6941 3.0492 View CSV PDB