Project name: HSA7A8_prot3D_74_015M

Status: done

Started: 2026-02-25 09:15:25
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQSYDSSLGGWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSGGSSLGDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/39d417590222055/tmp/folded.pdb                (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:21)
Show buried residues

Minimal score value
-2.8428
Maximal score value
1.5418
Average score
-0.4749
Total score value
-108.7622

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.3240
2 S A 0.5525
3 V A 1.4435
4 L A 0.0000
5 T A 0.1093
6 Q A 0.0000
7 P A -0.3971
8 P A -0.5763
9 S A -0.4392
11 V A -0.0253
12 S A -0.1174
13 G A 0.0000
14 A A -0.2119
15 P A -0.9598
16 G A -1.8156
17 Q A -2.3890
18 R A -2.6794
19 V A 0.0000
20 T A -0.5109
21 I A 0.0000
22 S A -0.3376
23 C A 0.0000
24 T A -0.1776
25 G A 0.0136
26 S A -0.1711
27 S A -0.6248
28 S A -0.1532
29 N A 0.0000
30 I A 0.0000
31 G A -0.7905
35 A A -0.4686
36 G A -0.5713
37 Y A -0.2247
38 D A -0.9728
39 V A 0.0000
40 H A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 Q A 0.0000
44 Q A 0.0000
45 L A -0.1911
46 P A -0.4312
47 G A -0.4280
48 T A -0.4128
49 A A -0.4400
50 P A 0.0000
51 K A -0.7806
52 L A -0.5234
53 L A 0.0000
54 I A 0.0000
55 Y A -0.7813
56 G A -1.0258
57 N A -1.1538
65 S A -1.3531
66 N A -1.8811
67 R A -2.0069
68 P A -1.1489
69 S A -0.6701
70 G A -0.9294
71 V A -0.7597
72 P A -1.2296
74 D A -2.1520
75 R A -1.5182
76 F A 0.0000
77 S A -0.9356
78 G A -0.7804
79 S A -0.7952
80 K A -1.1534
83 S A -0.8074
84 G A -0.9101
85 T A -0.6757
86 S A -0.6349
87 A A 0.0000
88 S A -0.4398
89 L A 0.0000
90 A A 0.0000
91 I A 0.0000
92 T A -1.9051
93 G A -1.8843
94 L A 0.0000
95 Q A -1.6878
96 A A -1.2875
97 E A -2.1794
98 D A 0.0000
99 E A -1.3327
100 A A 0.0000
101 D A -0.5739
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 S A 0.0000
107 Y A 0.2913
108 D A 0.0000
109 S A 0.1544
110 S A 0.3049
113 L A 1.1227
114 G A 0.7415
115 G A 0.0000
116 W A 0.6495
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4002
121 G A 0.0000
122 T A 0.0000
123 K A -0.6763
124 V A 0.0000
125 T A 0.1455
126 V A 0.2588
127 L A 1.3550
1 Q B -0.8522
2 V B 0.2593
3 Q B -0.2330
4 L B 0.0000
5 V B 0.7548
6 Q B 0.0373
7 S B -0.6700
8 G B -0.8607
9 G B -0.5579
11 G B 0.4389
12 V B 1.5418
13 V B 0.1731
14 Q B -1.5061
15 P B -2.2281
16 G B -2.2288
17 R B -2.8428
18 S B -2.1408
19 L B -1.2525
20 R B -2.0784
21 L B 0.0000
22 S B -0.5206
23 C B 0.0000
24 A B -0.1740
25 A B -0.1000
26 S B -0.2668
27 G B -0.2679
28 F B 0.0743
29 T B -0.4137
30 F B -0.2482
35 S B 0.1694
36 S B 0.6539
37 Y B 1.2285
38 G B 0.6151
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.6843
45 A B -0.9603
46 P B -0.9598
47 G B -1.4743
48 K B -2.1894
49 G B -1.4060
50 L B 0.0000
51 E B -0.4422
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.3105
58 Y B 0.6637
59 D B -1.4554
62 G B -0.8793
63 S B -0.7779
64 N B -0.4724
65 K B -0.3904
66 Y B 0.4637
67 Y B -0.2164
68 A B 0.0000
69 D B -2.2287
70 S B -1.8356
71 V B 0.0000
72 K B -2.3943
74 G B -1.6521
75 R B 0.0000
76 F B 0.0000
77 T B -0.6960
78 I B 0.0000
79 S B -0.7104
80 R B -1.1530
81 D B -1.5800
82 N B -1.6139
83 S B -1.5135
84 K B -2.2230
85 N B -1.4411
86 T B -0.9340
87 L B 0.0000
88 Y B -0.5239
89 L B 0.0000
90 Q B -1.1678
91 M B 0.0000
92 N B -2.2220
93 S B -2.0080
94 L B 0.0000
95 R B -2.6806
96 A B -1.5577
97 E B -1.6974
98 D B 0.0000
99 T B -0.2888
100 A B 0.0000
101 V B 0.2634
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.3753
107 S B 0.0000
108 G B -0.2078
109 G B -0.2160
110 S B -0.4444
113 S B -0.3335
114 L B 0.0000
115 G B 0.0000
116 D B -1.0887
117 V B -0.4045
118 W B -0.3213
119 G B 0.0000
120 Q B -0.9575
121 G B -0.4491
122 T B 0.0000
123 T B 0.0684
124 V B 0.0000
125 T B 0.3527
126 V B -0.6256
127 S B -0.3941
128 S B -0.4685
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4424 2.2585 View CSV PDB
4.5 -0.4732 2.2415 View CSV PDB
5.0 -0.5071 2.2211 View CSV PDB
5.5 -0.5397 2.2005 View CSV PDB
6.0 -0.566 2.183 View CSV PDB
6.5 -0.5823 2.1714 View CSV PDB
7.0 -0.5893 2.1658 View CSV PDB
7.5 -0.5903 2.1637 View CSV PDB
8.0 -0.5871 2.1629 View CSV PDB
8.5 -0.5788 2.1627 View CSV PDB
9.0 -0.5644 2.1626 View CSV PDB