Project name: 5B5 MUTANT ANTIBODY 8

Status: done

Started: 2026-03-17 05:33:34
Chain sequence(s) A: DIVMTQTPLSLPVTPGEPASISCRSSQSLVHSNGNTYLEWYLQKPGQSPQLLIYKLSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGSGTKLEIKGGGGSGGGGSGGGGSVQLVQSGAEVKKPGASVKVSCKASGYTFTDYIMLWVRQAPGQGLEWMGNIDPYYGSTGYALKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDGNYGSDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3a6d83742ae0d35/tmp/folded.pdb                (00:02:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:35)
Show buried residues

Minimal score value
-3.2967
Maximal score value
1.7318
Average score
-0.6375
Total score value
-154.9021

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -0.9416
2 I A 0.0000
3 V A 0.8235
4 M A 0.0000
5 T A -0.2799
6 Q A 0.0000
7 T A 0.0217
8 P A 0.4269
9 L A 1.1843
10 S A 0.0815
11 L A -0.2571
12 P A -1.1140
13 V A 0.0000
14 T A -1.6846
15 P A -2.0108
16 G A -1.8707
17 E A -2.3284
18 P A -2.2290
19 A A 0.0000
20 S A -0.9047
21 I A 0.0000
22 S A -0.9192
23 C A 0.0000
24 R A -2.2193
25 S A 0.0000
26 S A -0.8043
27 Q A -1.0608
28 S A -0.6541
29 L A 0.0000
30 V A 0.2927
31 H A -0.6076
32 S A -0.9454
33 N A -1.6368
34 G A -1.0887
35 N A -0.8911
36 T A -0.3457
37 Y A -0.0234
38 L A 0.0000
39 E A -0.3584
40 W A 0.0000
41 Y A 0.0000
42 L A 0.0000
43 Q A -1.0163
44 K A -1.8563
45 P A -1.2606
46 G A -1.5913
47 Q A -2.2445
48 S A -1.2997
49 P A 0.0000
50 Q A -0.8415
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 Y A -0.6069
55 K A -1.0192
56 L A -0.8024
57 S A -1.0518
58 N A -1.3028
59 R A -1.6549
60 F A -0.6069
61 S A -0.5071
62 G A -0.8837
63 V A -0.8943
64 P A -1.2706
65 D A -2.4167
66 R A -2.2002
67 F A 0.0000
68 S A -1.5922
69 G A 0.0000
70 S A -1.0441
71 G A -1.0459
72 S A -0.7436
73 G A -0.6095
74 T A -1.3410
75 D A -2.0386
76 F A 0.0000
77 T A -1.1826
78 L A 0.0000
79 K A -2.2357
80 I A 0.0000
81 S A -2.4396
82 R A -3.2967
83 V A 0.0000
84 E A -2.3047
85 A A -1.6680
86 E A -2.4593
87 D A 0.0000
88 V A -1.0639
89 G A 0.0000
90 V A -0.2201
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 F A 0.0000
95 Q A 0.0000
96 G A 0.2727
97 S A 0.0000
98 H A 0.4633
99 V A 1.5698
100 P A 0.7240
101 F A 0.7760
102 T A 0.4184
103 F A 0.3471
104 G A 0.0000
105 S A -0.0386
106 G A 0.0000
107 T A 0.0000
108 K A -0.6793
109 L A 0.0000
110 E A -1.6654
111 I A -1.8083
112 K A -2.3803
113 G A -1.7947
114 G A -1.7084
115 G A -1.3354
116 G A -1.6730
117 S A -1.2486
118 G A -1.6249
119 G A -1.6775
120 G A -1.7315
121 G A -1.7199
122 S A -1.0757
123 G A -1.3062
124 G A -1.2321
125 G A -1.2074
126 G A -1.0839
127 S A -0.9197
128 V A -0.7133
129 Q A -1.5011
130 L A 0.0000
131 V A -0.5480
132 Q A 0.0000
133 S A -0.7506
134 G A -0.7282
135 A A -0.1106
136 E A -0.2462
137 V A 0.8273
138 K A -0.9595
139 K A -2.1245
140 P A -2.1397
141 G A -1.4843
142 A A -1.1845
143 S A -1.2406
144 V A 0.0000
145 K A -1.7140
146 V A 0.0000
147 S A -0.7273
148 C A 0.0000
149 K A -1.3672
150 A A 0.0000
151 S A -0.8780
152 G A -0.7845
153 Y A -0.5171
154 T A -0.5987
155 F A 0.0000
156 T A -0.1209
157 D A -1.4139
158 Y A -0.6525
159 I A 0.1360
160 M A 0.0000
161 L A 0.0000
162 W A 0.0000
163 V A 0.0000
164 R A 0.0000
165 Q A -0.5646
166 A A -0.9991
167 P A -1.0158
168 G A -1.2115
169 Q A -1.6771
170 G A -0.9526
171 L A 0.0000
172 E A -0.4962
173 W A 0.0000
174 M A 0.0000
175 G A 0.0000
176 N A -0.2759
177 I A 0.0000
178 D A 0.1865
179 P A 0.0000
180 Y A 1.4239
181 Y A 1.7318
182 G A 0.4839
183 S A 0.1744
184 T A -0.1149
185 G A -0.0092
186 Y A -0.0789
187 A A 0.0000
188 L A 0.0424
189 K A -1.5301
190 F A 0.0000
191 K A -1.9395
192 G A -1.4765
193 R A -1.3621
194 V A 0.0000
195 T A -0.8771
196 M A 0.0000
197 T A -0.6442
198 R A -0.9001
199 D A -1.2220
200 T A -0.5175
201 S A -0.5613
202 T A -0.7026
203 S A -0.8113
204 T A 0.0000
205 V A 0.0000
206 Y A -0.7675
207 M A 0.0000
208 E A -1.3818
209 L A 0.0000
210 S A -1.0182
211 S A -1.0701
212 L A 0.0000
213 R A -2.7725
214 S A -2.2459
215 E A -2.4613
216 D A 0.0000
217 T A -0.8583
218 A A 0.0000
219 V A 0.2371
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 A A 0.0000
224 R A 0.0000
225 D A -0.9925
226 G A -0.8889
227 N A -1.0680
228 Y A -0.4013
229 G A -0.3622
230 S A 0.0000
231 D A 0.0000
232 Y A -0.1908
233 W A -0.4440
234 G A 0.0000
235 Q A -1.4582
236 G A -0.6589
237 T A 0.0000
238 T A -0.0020
239 V A 0.0000
240 T A -0.3323
241 V A 0.0000
242 S A -0.8651
243 S A -1.1626
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5951 1.9904 View CSV PDB
4.5 -0.6294 1.9073 View CSV PDB
5.0 -0.6694 1.8038 View CSV PDB
5.5 -0.7063 1.6909 View CSV PDB
6.0 -0.7309 1.6465 View CSV PDB
6.5 -0.7377 1.629 View CSV PDB
7.0 -0.7281 1.6116 View CSV PDB
7.5 -0.7078 1.5947 View CSV PDB
8.0 -0.6817 1.5788 View CSV PDB
8.5 -0.6511 1.5644 View CSV PDB
9.0 -0.6158 1.5625 View CSV PDB