Project name: 3ab1e3eccc3ee5

Status: done

Started: 2026-05-24 12:28:36
Chain sequence(s) A: GNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3ab1e3eccc3ee5/tmp/folded.pdb                 (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:15)
Show buried residues

Minimal score value
-4.0047
Maximal score value
3.2036
Average score
-0.5795
Total score value
-125.7614

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1532 G A -0.3090
1533 N A -0.1256
1534 C A 0.0000
1535 Y A -0.4144
1536 L A -0.5904
1537 D A -1.1301
1538 I A -1.2243
1539 R A -2.5761
1540 P A -3.1017
1541 R A -4.0047
1542 G A -3.3734
1543 D A -3.5300
1544 N A -3.4700
1545 G A -3.0773
1546 D A -3.9076
1547 T A -2.5835
1548 A A -1.8389
1549 C A -1.2248
1550 S A -0.8894
1551 N A -1.2099
1552 E A -0.9805
1553 I A 0.0000
1554 G A 0.0000
1555 V A 1.1164
1556 G A 0.1156
1557 V A 0.0499
1558 S A -0.4323
1559 K A -0.9121
1560 A A -0.3181
1561 S A 0.0000
1562 C A 0.0000
1563 C A 0.0000
1564 C A 0.0000
1565 S A -0.3606
1566 L A 0.4543
1567 G A -0.1216
1568 K A -0.5598
1569 A A 0.0000
1570 W A -0.4119
1571 G A 0.0000
1572 T A -0.5123
1573 P A -0.8679
1574 C A -0.7470
1575 E A -1.0616
1576 M A 0.0690
1577 C A 0.0000
1578 P A -0.3375
1579 A A -0.0374
1580 V A 0.2919
1581 N A -1.0147
1582 T A -0.9373
1583 S A -1.1614
1584 E A -1.6497
1585 Y A 0.0000
1586 K A -1.2985
1587 I A 0.5382
1588 L A 0.0845
1589 C A 0.0000
1590 P A -0.3775
1591 G A -0.5345
1592 G A -0.8837
1593 E A -1.5832
1594 G A 0.0000
1595 F A -0.2319
1596 R A -0.1319
1597 P A 1.6510
1598 N A 1.5959
1599 P A 1.4067
1600 I A 2.6073
1601 T A 2.3849
1602 V A 3.1691
1603 I A 3.2036
1604 L A 1.5954
1605 E A 0.5574
1606 D A -0.2450
1607 I A 0.0000
1608 D A -0.6303
1609 E A 0.0000
1610 C A -0.9761
1611 Q A -1.4439
1612 E A -0.6959
1613 L A 0.0000
1614 P A -0.8934
1615 G A -0.5001
1616 L A 0.0000
1617 C A 0.0000
1618 Q A -0.9752
1619 G A -1.0645
1620 G A -1.6130
1621 K A -2.5141
1622 C A -1.4511
1623 I A -0.6028
1624 N A -0.3432
1625 T A 0.6074
1626 F A 1.6162
1627 G A 0.1658
1628 S A 0.0735
1629 F A 0.1277
1630 Q A -1.2185
1631 C A -1.3615
1632 R A -2.2943
1633 C A -1.1083
1634 P A -0.7374
1635 T A -0.2284
1636 G A 0.0670
1637 Y A 0.4415
1638 Y A 0.6444
1639 L A -0.3037
1640 N A -1.2183
1641 E A -2.4767
1642 D A -2.6798
1643 T A -1.4877
1644 R A 0.0000
1645 V A -0.3286
1646 C A 0.0000
1647 D A 0.0448
1648 D A 0.1235
1649 V A -0.0740
1650 N A -1.3074
1651 E A -1.1939
1652 C A -0.9476
1653 E A -2.1717
1654 T A -1.2246
1655 P A -0.8566
1656 G A -0.7371
1657 I A -0.3419
1658 C A 0.0000
1659 G A -0.5246
1660 P A -0.2370
1661 G A 0.5287
1662 T A 0.8505
1663 C A 0.6875
1664 Y A 1.3317
1665 N A 0.0027
1666 T A 0.4965
1667 V A 1.1583
1668 G A 0.1581
1669 N A -0.5244
1670 Y A -0.0125
1671 T A 0.4153
1672 C A 0.0000
1673 I A 2.0715
1674 C A 0.7078
1675 P A -0.0303
1676 P A -0.7091
1677 D A -1.5785
1678 Y A -0.1105
1679 M A 0.5780
1680 Q A -0.2496
1681 V A -0.7097
1682 N A -1.7269
1683 G A -1.3207
1684 G A 0.0000
1685 N A -0.8214
1686 N A -0.6408
1687 C A 0.0000
1688 M A -0.0865
1689 D A 0.0000
1690 M A -0.3455
1691 R A -1.8165
1692 R A -2.1750
1693 S A -1.3766
1694 L A -0.6537
1695 C A 0.0000
1696 Y A 0.0000
1697 R A -2.9544
1698 N A -2.1786
1699 Y A -1.7393
1700 Y A -0.9407
1701 A A -1.3772
1702 D A -2.4616
1703 N A -2.4613
1704 Q A -2.3467
1705 T A -1.4852
1706 C A -2.0554
1707 D A -2.1075
1708 G A -2.1777
1709 E A -1.9294
1710 L A 0.1894
1711 L A 2.0149
1712 F A 1.9348
1713 N A -0.2839
1714 M A 0.0000
1715 T A -1.2108
1716 K A -1.1466
1717 K A -0.6908
1718 M A -0.2014
1719 C A 0.0000
1720 C A 0.0000
1721 C A 0.0390
1722 S A 0.2145
1723 Y A 0.8520
1724 N A -0.7541
1725 I A -0.3016
1726 G A -1.6961
1727 R A -2.6127
1728 A A 0.0000
1729 W A 0.0000
1730 N A -1.9507
1731 K A -2.0647
1732 P A -1.6685
1733 C A -1.9969
1734 E A -2.4338
1735 Q A -1.6974
1736 C A 0.0000
1737 P A -0.4375
1738 I A 0.9831
1739 P A 0.1492
1740 S A -0.4255
1741 T A -0.9886
1742 D A -2.3404
1743 E A -2.2127
1744 F A -0.6681
1745 A A -0.7966
1746 T A -1.1240
1747 L A 0.0000
1748 C A -0.0670
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.0943 4.7276 View CSV PDB
4.5 0.0143 4.7008 View CSV PDB
5.0 -0.082 4.6812 View CSV PDB
5.5 -0.1802 4.6812 View CSV PDB
6.0 -0.2665 4.6812 View CSV PDB
6.5 -0.3298 4.6812 View CSV PDB
7.0 -0.3679 4.6812 View CSV PDB
7.5 -0.388 4.6812 View CSV PDB
8.0 -0.3976 4.6812 View CSV PDB
8.5 -0.3982 4.6812 View CSV PDB
9.0 -0.3881 4.6812 View CSV PDB