Project name: GFP_evolmut [mutate: EL5A]

Status: done

Started: 2026-07-20 18:51:38
Chain sequence(s) A: KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues EL5A
Energy difference between WT (input) and mutated protein (by FoldX) -1.11157 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:02:43)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:50)
Show buried residues

Minimal score value
-4.2294
Maximal score value
1.3969
Average score
-1.0059
Total score value
-227.3442

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
3 K A -2.0780
4 G A 0.0000
5 L A -1.3281 mutated: EL5A
6 E A -1.9343
7 L A -0.5017
8 F A 0.0000
9 T A -0.0140
10 G A 0.5404
11 V A 1.3969
12 V A 0.0000
13 P A -0.9172
14 I A 0.0000
15 L A -1.3292
16 V A 0.0000
17 E A -2.6534
18 L A 0.0000
19 D A -3.6043
20 G A 0.0000
21 D A -2.7988
22 V A 0.0000
23 N A -2.1185
24 G A -1.7269
25 H A -2.2722
26 K A -3.0116
27 F A 0.0000
28 S A -1.9013
29 V A 0.0000
30 S A -1.2907
31 G A 0.0000
32 E A -2.2842
33 G A -1.6796
34 E A -1.4215
35 G A 0.0000
36 D A 0.2104
37 A A 0.0000
38 T A 0.2206
39 Y A 1.0140
40 G A 0.0000
41 K A -0.2146
42 L A 0.0000
43 T A -0.7199
44 L A 0.0000
45 K A -1.2134
46 F A 0.0000
47 I A -0.9471
48 C A 0.0000
49 T A -1.0302
50 T A -1.3141
51 G A -1.6091
52 K A -2.2482
53 L A 0.0000
54 P A -1.2314
55 V A 0.0000
56 P A -0.7360
57 W A 0.0000
58 P A 0.0000
59 T A 0.0000
60 L A 0.0000
61 V A 0.0000
62 T A -0.0006
63 T A 0.0000
64 L A 0.0000
68 V A 0.0102
69 Q A -0.1871
70 C A 0.0000
71 F A 0.0000
72 S A 0.0000
73 R A -1.2948
74 Y A 0.0000
75 P A -1.9677
76 D A -2.9187
77 H A -2.1423
78 M A 0.0000
79 K A -3.0242
80 R A -2.8994
81 H A -1.8383
82 D A 0.0000
83 F A 0.0000
84 F A 0.0000
85 K A 0.0000
86 S A -0.9136
87 A A 0.0000
88 M A 0.0000
89 P A -1.4533
90 E A -2.1531
91 G A 0.0000
92 Y A 0.0000
93 V A -0.7941
94 Q A 0.0000
95 E A -2.2940
96 R A 0.0000
97 T A -1.0286
98 I A 0.0000
99 S A -1.2900
100 F A 0.0000
101 K A -2.5517
102 D A -2.9540
103 D A -2.9182
104 G A 0.0000
105 N A -1.5610
106 Y A 0.0000
107 K A -2.4910
108 T A 0.0000
109 R A -3.3275
110 A A 0.0000
111 E A -2.2198
112 V A 0.0000
113 K A -1.5861
114 F A -1.7918
115 E A -2.5567
116 G A -2.1955
117 D A -2.3584
118 T A -1.5079
119 L A 0.0000
120 V A 0.0000
121 N A 0.0000
122 R A -3.4023
123 I A 0.0000
124 E A -4.2294
125 L A 0.0000
126 K A -3.0278
127 G A 0.0000
128 I A -1.2594
129 D A -2.3033
130 F A 0.0000
131 K A -3.9613
132 E A -3.9948
133 D A -3.6462
134 G A -2.8657
135 N A -2.3101
136 I A 0.0000
137 L A -2.0276
138 G A -2.3605
139 H A -2.2587
140 K A -2.5872
141 L A -1.9192
142 E A -2.3760
143 Y A -1.0267
144 N A -0.7168
145 Y A -0.8126
146 N A -1.0282
147 S A -1.0139
148 H A 0.0000
149 N A -1.4408
150 V A 0.0000
151 Y A -0.0056
152 I A 0.0000
153 T A -1.1386
154 A A -1.7284
155 D A -2.2382
156 K A -3.2159
157 Q A -3.1719
158 K A -3.2541
159 N A -2.8825
160 G A 0.0000
161 I A 0.0000
162 K A -1.0611
163 A A 0.0000
164 N A -1.2396
165 F A 0.0000
166 K A -1.8023
167 I A 0.0000
168 R A -1.1817
169 H A 0.0000
170 N A -1.4605
171 I A 0.0000
172 E A -3.4406
173 D A -3.0570
174 G A -1.8661
175 S A -0.7935
176 V A 0.1348
177 Q A 0.0000
178 L A -0.9274
179 A A 0.0000
180 D A -1.4370
181 H A 0.0000
182 Y A -0.3306
183 Q A 0.0000
184 Q A -1.0811
185 N A 0.0000
186 T A -0.7626
187 P A -0.8685
188 I A -0.3091
189 G A -1.3016
190 D A -2.1167
191 G A -1.4745
192 P A -0.7956
193 V A -0.1116
194 L A -0.2825
195 L A -0.6667
196 P A 0.0000
197 D A -2.4758
198 N A -1.8700
199 H A 0.0000
200 Y A -0.2909
201 L A 0.0000
202 S A -0.6361
203 T A -0.8033
204 Q A -1.1174
205 S A -0.3965
206 A A 0.0732
207 L A -0.0944
208 S A -0.7443
209 K A -2.0175
210 D A -2.1546
211 P A -1.8421
212 N A -2.4878
213 E A -2.7166
214 K A -3.3343
215 R A -3.3491
216 D A -2.2414
217 H A 0.0000
218 M A 0.0000
219 V A -0.3785
220 L A 0.0000
221 L A 0.4436
222 E A 0.0266
223 F A 0.4936
224 V A 0.0000
225 T A -0.4137
226 A A 0.0000
227 A A -0.4099
228 G A -0.6590
229 I A -0.7067
230 T A -0.5586
231 H A -1.2895
Download PDB file
View in 3Dmol