Project name: 3c9c8a9b434561

Status: done

Started: 2026-03-23 11:34:51
Chain sequence(s) A: EVQLVESGGGLVKPGGSLKVSCAASGFTFSSYVLSWVRQTPEKRLEWVATITSDGSSTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARDSGGFDYWGAGTTVTVSS
B: DIVMTQSHKFMSTSVGDRVSITCKASQDIDDYLNWYQEKPGQCPKLLIYGASSLESGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQYFDLTVTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:36)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3c9c8a9b434561/tmp/folded.pdb                 (00:02:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:47)
Show buried residues

Minimal score value
-3.6689
Maximal score value
1.2814
Average score
-0.6814
Total score value
-151.9422

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.0420
2 V A -1.0912
3 Q A -1.0579
4 L A 0.0000
5 V A 0.7755
6 E A 0.0000
7 S A -0.3845
8 G A -0.9469
9 G A -0.4431
10 G A 0.2528
11 L A 1.1007
12 V A -0.2778
13 K A -1.8604
14 P A -1.8190
15 G A -1.4769
16 G A -0.9714
17 S A -1.0730
18 L A -0.6794
19 K A -1.8300
20 V A 0.0000
21 S A -0.3538
22 C A 0.0000
23 A A -0.2026
24 A A 0.0000
25 S A -0.9236
26 G A -1.1122
27 F A -0.4559
28 T A -0.1985
29 F A 0.0000
30 S A -0.8583
31 S A -0.4292
32 Y A -0.0912
33 V A 0.0011
34 L A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A -2.2369
41 P A -2.2247
42 E A -3.3826
43 K A -3.6689
44 R A -3.4741
45 L A 0.0000
46 E A -0.8899
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.3455
51 I A 0.0000
52 T A -0.5689
53 S A -0.9950
54 D A -2.1068
55 G A -1.3705
56 S A -0.9569
57 S A -0.4538
58 T A 0.1092
59 Y A 0.3221
60 Y A -0.5316
61 P A -1.3043
62 D A -2.5115
63 S A -1.8191
64 V A 0.0000
65 K A -2.5752
66 G A -1.7168
67 R A -1.3435
68 F A 0.0000
69 T A -0.7075
70 I A 0.0000
71 S A -0.3926
72 R A -1.1701
73 D A -1.6293
74 N A -1.8905
75 A A -1.3324
76 K A -2.2201
77 N A -1.6219
78 T A -0.9148
79 L A 0.0000
80 Y A -0.3020
81 L A 0.0000
82 Q A -1.1043
83 M A 0.0000
84 S A -0.9641
85 S A -1.0805
86 L A 0.0000
87 R A -2.4326
88 S A -2.0809
89 E A -2.4086
90 D A 0.0000
91 T A -0.7367
92 A A 0.0000
93 M A -0.0090
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 D A -0.5052
100 S A -0.5284
101 G A -0.4864
102 G A 0.0000
103 F A 0.0000
104 D A -0.5209
105 Y A 0.0516
106 W A 0.0000
107 G A 0.0000
108 A A -0.0282
109 G A 0.0588
110 T A -0.0554
111 T A 0.0765
112 V A 0.0000
113 T A -0.1994
114 V A 0.0000
115 S A -0.9896
116 S A -0.7623
1 D B -1.4350
2 I B 0.0000
3 V B 0.7592
4 M B 0.0000
5 T B -0.8109
6 Q B -1.1733
7 S B -1.1515
8 H B -1.3301
9 K B -1.4821
10 F B 0.3701
11 M B -0.0349
12 S B -0.5236
13 T B 0.0000
14 S B -1.1302
15 V B -0.2973
16 G B -1.6099
17 D B -2.7118
18 R B -2.9177
19 V B 0.0000
20 S B -0.4756
21 I B 0.0000
22 T B -0.9129
23 C B 0.0000
24 K B -2.1127
25 A B 0.0000
26 S B -1.1196
27 Q B -2.0983
28 D B -2.9359
29 I B 0.0000
30 D B -2.3143
31 D B -1.4207
32 Y B 0.0507
33 L B 0.0000
34 N B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 E B -1.2388
39 K B -1.6230
40 P B -1.0654
41 G B -1.2891
42 Q B -1.7969
43 C B -0.8794
44 P B 0.0000
45 K B -1.4196
46 L B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.4380
50 G B -0.1391
51 A B 0.0000
52 S B -0.2596
53 S B 0.0376
54 L B -0.2328
55 E B -0.6998
56 S B -0.7691
57 G B -0.8750
58 V B 0.0000
59 P B -1.2684
60 D B -2.0688
61 R B -1.8141
62 L B 0.0000
63 T B -0.5975
64 G B 0.0000
65 S B -0.7715
66 G B -1.4054
67 S B -1.9136
68 G B -2.3980
69 T B -2.5616
70 D B -2.7060
71 F B 0.0000
72 T B -0.7247
73 L B 0.0000
74 T B -0.6643
75 I B 0.0000
76 S B -2.2104
77 N B -2.5051
78 V B 0.0000
79 E B -1.5068
80 S B -1.3881
81 E B -1.8414
82 D B 0.0000
83 L B -1.0425
84 A B 0.0000
85 D B -0.9580
86 Y B 0.0000
87 F B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 Y B 0.9793
92 F B 0.7778
93 D B 0.1941
94 L B 1.2814
95 T B 0.1431
96 V B 0.5672
97 T B 0.2649
98 F B 0.0000
99 G B 0.0000
100 G B -1.9304
101 G B 0.0000
102 T B 0.0000
103 K B -0.8050
104 L B 0.0000
105 E B -1.2029
106 I B -0.9881
107 K B -1.5574
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6428 3.5763 View CSV PDB
4.5 -0.7064 3.3446 View CSV PDB
5.0 -0.78 3.0784 View CSV PDB
5.5 -0.851 2.7943 View CSV PDB
6.0 -0.9069 2.5031 View CSV PDB
6.5 -0.9405 2.2101 View CSV PDB
7.0 -0.9532 1.9183 View CSV PDB
7.5 -0.9513 1.6521 View CSV PDB
8.0 -0.9394 1.9414 View CSV PDB
8.5 -0.918 2.2337 View CSV PDB
9.0 -0.8856 2.5254 View CSV PDB