Project name: new 8

Status: done

Started: 2026-03-17 06:30:51
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGSGRDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSAISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:12)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:43)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3ca1e2af4701636/tmp/folded.pdb                (00:02:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:08)
Show buried residues

Minimal score value
-3.9417
Maximal score value
1.5306
Average score
-0.7048
Total score value
-174.0936

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8060
2 I A 0.0000
3 V A 0.7433
4 L A 0.0000
5 T A -0.6770
6 Q A -0.6440
7 S A -0.7063
8 P A -0.3185
9 A A -0.3553
10 T A -0.4409
11 L A -0.2420
12 S A -0.6307
13 L A -0.9697
14 S A -1.3591
15 P A -1.7680
16 G A -1.9513
17 E A -2.5143
18 R A -2.6637
19 A A 0.0000
20 T A -0.6327
21 L A 0.0000
22 S A -1.0131
23 C A 0.0000
24 R A -3.1533
25 V A 0.0000
26 S A -1.5642
27 Q A -2.9234
28 N A -3.3194
29 V A 0.0000
30 S A -1.7257
31 S A -1.1332
32 N A -1.2889
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.5079
40 P A -1.1139
41 G A -1.3222
42 Q A -1.6907
43 A A -1.0694
44 P A 0.0000
45 R A -0.8520
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A -0.5227
50 D A -0.5487
51 T A 0.0000
52 S A -0.9598
53 N A -1.2664
54 R A -1.5052
55 A A 0.0000
56 T A -0.7467
57 G A -0.6666
58 I A -0.5377
59 P A -0.3917
60 A A -0.3948
61 R A -0.9469
62 F A 0.0000
63 S A -0.6665
64 G A 0.0000
65 S A -0.8459
66 G A -1.5622
67 S A -1.7228
68 G A -2.5473
69 R A -3.9417
70 D A -3.7702
71 F A 0.0000
72 T A -0.9140
73 L A 0.0000
74 T A -0.6284
75 I A 0.0000
76 S A -1.5797
77 S A -1.9568
78 L A 0.0000
79 E A -2.4753
80 P A -1.8379
81 E A -2.6656
82 D A 0.0000
83 F A -0.8848
84 A A 0.0000
85 V A -0.2884
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A 0.0000
92 R A -2.4763
93 N A -2.2304
94 W A -0.7856
95 P A -0.9301
96 L A 0.0000
97 T A 0.0000
98 F A 0.1658
99 G A 0.0000
100 G A -0.7760
101 G A -0.7227
102 T A 0.0000
103 K A -0.9044
104 V A 0.0000
105 E A -0.8100
106 I A -0.4115
107 K A -1.7024
108 G A -1.4005
109 G A -1.2028
110 G A -1.2033
111 G A -1.2229
112 S A -1.0542
113 G A -1.3625
114 G A -1.5825
115 G A -1.7154
116 G A -1.7584
117 S A -1.2062
118 G A -1.5748
119 G A -1.2292
120 G A -1.5029
121 G A -1.5932
122 S A -1.7067
123 E A -2.4234
124 V A -1.6218
125 Q A -1.4786
126 L A 0.0000
127 V A 1.1293
128 E A 0.0000
129 S A -0.1698
130 G A -0.6558
131 G A 0.0513
132 G A 0.5795
133 L A 1.2763
134 V A 0.0000
135 Q A -1.4011
136 P A -1.6210
137 G A -1.4519
138 G A -1.0263
139 S A -1.3422
140 L A -1.0919
141 R A -2.1584
142 L A 0.0000
143 S A -0.3701
144 C A 0.0000
145 A A -0.0825
146 A A 0.0000
147 S A -0.8506
148 G A -1.2431
149 F A -0.8896
150 T A -0.6688
151 F A 0.0000
152 S A -1.5610
153 R A -1.8424
154 Y A -0.7871
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6722
162 A A -1.0758
163 P A -0.8468
164 G A -1.4493
165 K A -2.2748
166 G A -1.3753
167 L A 0.0000
168 E A -0.9997
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 A A 0.0000
173 I A 0.0000
174 S A 0.0000
175 A A -0.8321
176 S A -0.7980
177 G A -0.4512
178 A A -0.1256
179 T A -0.0222
180 T A 0.1460
181 Y A 0.1306
182 Y A -0.5592
183 A A 0.0000
184 D A -2.5222
185 P A -1.6867
186 V A 0.0000
187 K A -2.3871
188 G A -1.6655
189 R A -1.4621
190 F A 0.0000
191 T A -0.7884
192 I A 0.0000
193 S A -0.4233
194 R A -1.0119
195 D A -1.6385
196 N A -1.8994
197 S A -1.5959
198 K A -2.3923
199 N A -1.7655
200 T A -0.9998
201 L A 0.0000
202 Y A -0.5658
203 L A 0.0000
204 Q A -1.2814
205 M A 0.0000
206 N A -1.5642
207 S A -1.3010
208 L A 0.0000
209 R A -2.2230
210 A A -1.6866
211 E A -2.1990
212 D A 0.0000
213 T A -0.4104
214 A A 0.0000
215 V A 0.6557
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -0.9151
224 F A 0.3914
225 D A -0.7763
226 I A 0.4041
227 L A 1.5306
228 T A 0.8828
229 G A 0.7334
230 Y A 1.3896
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -0.6216
236 P A -0.7775
237 W A 0.0000
238 G A 0.0000
239 Q A -1.1287
240 G A 0.0000
241 T A 0.5528
242 L A 1.5113
243 V A 0.0000
244 T A 0.2420
245 V A 0.0000
246 S A -0.8007
247 S A -0.7035
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5752 3.3723 View CSV PDB
4.5 -0.614 3.038 View CSV PDB
5.0 -0.66 2.7114 View CSV PDB
5.5 -0.7063 2.5637 View CSV PDB
6.0 -0.7454 2.4152 View CSV PDB
6.5 -0.7709 2.2672 View CSV PDB
7.0 -0.7817 2.1733 View CSV PDB
7.5 -0.782 2.1733 View CSV PDB
8.0 -0.7756 2.1733 View CSV PDB
8.5 -0.7639 2.1733 View CSV PDB
9.0 -0.7469 2.1733 View CSV PDB