Project name: 3cb189884b86ef7

Status: done

Started: 2026-06-02 15:49:40
Chain sequence(s) A: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:57)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3cb189884b86ef7/tmp/folded.pdb                (00:02:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:58)
Show buried residues

Minimal score value
-4.327
Maximal score value
2.7768
Average score
-1.0173
Total score value
-358.0849

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5941
2 A A -0.6015
3 E A -2.2434
4 P A -2.4245
5 R A -3.2311
6 Q A -2.9710
7 E A -2.2442
8 F A 0.2655
9 E A -0.6123
10 V A 0.9696
11 M A 0.1540
12 E A -2.2105
13 D A -2.6625
14 H A -2.3669
15 A A -1.2283
16 G A -0.6955
17 T A 0.3329
18 Y A 1.1888
19 G A 0.4787
20 L A 0.6452
21 G A -1.2534
22 D A -3.2539
23 R A -4.0443
24 K A -4.3270
25 D A -4.0607
26 Q A -2.9412
27 G A -1.3574
28 G A -0.4826
29 Y A 0.8973
30 T A 0.5252
31 M A 0.1899
32 H A -1.4947
33 Q A -2.8046
34 D A -3.6816
35 Q A -3.7390
36 E A -3.8197
37 G A -3.0653
38 D A -3.2182
39 T A -2.2573
40 D A -2.2885
41 A A -1.0790
42 G A -0.6494
43 L A 0.0753
44 K A -1.7630
45 A A -1.7819
46 E A -2.9864
47 E A -2.6992
48 A A -1.1045
49 G A -0.6149
50 I A 0.8262
51 G A -0.5414
52 D A -1.7148
53 T A -0.7400
54 P A -0.7801
55 S A -0.6415
56 L A -0.2434
57 E A -2.5279
58 D A -3.1394
59 E A -2.9857
60 A A -1.8330
61 A A -0.9898
62 G A -0.6693
63 H A -0.5111
64 V A 0.8203
65 T A -0.3510
66 Q A -1.2189
67 A A -0.7200
68 R A -1.1947
69 M A 0.6066
70 V A 1.1829
71 S A -0.3702
72 K A -1.9541
73 S A -2.1964
74 K A -3.2937
75 D A -3.1615
76 G A -1.9717
77 T A -1.3595
78 G A -1.4754
79 S A -1.9964
80 D A -3.2740
81 D A -3.9874
82 K A -3.8861
83 K A -3.2876
84 A A -2.0954
85 K A -2.2202
86 G A -1.6839
87 A A -1.5734
88 D A -2.4850
89 G A -2.3837
90 K A -2.5913
91 T A -1.4038
92 K A -1.2251
93 I A 0.9766
94 A A 0.3049
95 T A -0.2780
96 P A -1.0469
97 R A -2.1961
98 G A -1.4183
99 A A -0.6138
100 A A -0.2548
101 P A -0.4876
102 P A -1.0259
103 G A -1.6221
104 Q A -2.5626
105 K A -2.9268
106 G A -2.3492
107 Q A -2.2350
108 A A -1.4335
109 N A -1.7374
110 A A -0.9640
111 T A -0.7341
112 R A -1.0804
113 I A 0.9903
114 P A -0.1188
115 A A -0.6165
116 K A -1.8208
117 T A -1.1970
118 P A -0.7871
119 P A -0.4330
120 A A -0.6129
121 P A -1.1478
122 K A -1.9028
123 T A -1.1392
124 P A -0.8959
125 P A -0.5931
126 S A -0.8082
127 S A -1.0805
128 G A -1.6076
129 E A -2.5054
130 P A -1.8547
131 P A -1.7854
132 K A -2.5461
133 S A -2.0993
134 G A -2.4180
135 D A -3.2963
136 R A -2.9067
137 S A -1.5963
138 G A -0.7706
139 Y A 0.5866
140 S A 0.0171
141 S A -0.2911
142 P A -0.5555
143 G A -0.9099
144 S A -0.7736
145 P A -0.7778
146 G A -0.8750
147 T A -0.6502
148 P A -0.9542
149 G A -1.3087
150 S A -1.6848
151 R A -2.6590
152 S A -2.1836
153 R A -2.5097
154 T A -1.0159
155 P A -0.4705
156 S A 0.3298
157 L A 1.2127
158 P A 0.3048
159 T A -0.0717
160 P A -0.5673
161 P A -1.0817
162 T A -1.6935
163 R A -3.2412
164 E A -3.5815
165 P A -2.6340
166 K A -2.9562
167 K A -1.7118
168 V A 1.2179
169 A A 1.3341
170 V A 2.3626
171 V A 1.9426
172 R A -0.5491
173 T A -0.6454
174 P A -1.1831
175 P A -1.6296
176 K A -2.0979
177 S A -1.3817
178 P A -0.9755
179 S A -0.9112
180 S A -1.1110
181 A A -1.3665
182 K A -2.1851
183 S A -1.7091
184 R A -2.0496
185 L A -0.2551
186 Q A -1.0663
187 T A -0.2276
188 A A 0.2215
189 P A 0.5581
190 V A 1.7997
191 P A 0.6871
192 M A 1.0603
193 P A -0.1771
194 D A -1.5142
195 L A -0.1591
196 K A -1.9845
197 N A -1.6865
198 V A -0.2315
199 K A -1.5613
200 S A -1.0477
201 K A -1.1341
202 I A 0.4799
203 G A -0.9814
204 S A -0.7189
205 T A -1.0117
206 E A -2.3985
207 N A -2.5715
208 L A -0.9076
209 K A -2.5430
210 H A -2.8192
211 Q A -2.4075
212 P A -1.7368
213 G A -1.6044
214 G A -1.2605
215 G A -1.3250
216 K A -1.3333
217 V A 0.9591
218 Q A 0.8103
219 I A 2.7287
220 V A 2.7768
221 Y A 1.9372
222 K A -0.1124
223 P A 0.1697
224 V A 0.9498
225 D A -0.5554
226 L A 1.1266
227 S A -0.1093
228 K A -0.8054
229 V A 0.8518
230 T A 0.0892
231 S A -0.4515
232 K A -1.3769
233 C A -0.2978
234 G A -0.5427
235 S A 0.2185
236 L A 1.2853
237 G A -0.2451
238 N A -1.0801
239 I A 0.7250
240 H A -1.2331
241 H A -2.3648
242 K A -2.6482
243 P A -1.8859
244 G A -1.6540
245 G A -1.1817
246 G A -1.1965
247 Q A -1.0159
248 V A 0.3583
249 E A -1.0134
250 V A 0.1215
251 K A -1.9550
252 S A -1.9890
253 E A -2.8817
254 K A -2.5331
255 L A -1.0083
256 D A -2.0604
257 F A -0.6870
258 K A -2.4317
259 D A -3.0768
260 R A -2.2604
261 V A -0.6215
262 Q A -1.5190
263 S A -0.5445
264 K A -1.0158
265 I A 0.6695
266 G A -0.5256
267 S A 0.2500
268 L A 0.9817
269 D A -1.2137
270 N A -0.9198
271 I A 1.2930
272 T A 0.3566
273 H A -0.4182
274 V A 1.0695
275 P A -0.0859
276 G A -0.7786
277 G A -1.4075
278 G A -2.0370
279 N A -2.7272
280 K A -3.0668
281 K A -2.4682
282 I A -0.4684
283 E A -1.9695
284 T A -1.4230
285 H A -1.7751
286 K A -1.6329
287 L A -0.0538
288 T A -0.5135
289 F A -0.0377
290 R A -2.2212
291 E A -2.8846
292 N A -2.3250
293 A A -1.9371
294 K A -2.6786
295 A A -1.9530
296 K A -3.0189
297 T A -2.4104
298 D A -2.8636
299 H A -2.5482
300 G A -1.9482
301 A A -1.1200
302 E A -0.7761
303 I A 1.8710
304 V A 2.3514
305 Y A 1.5739
306 K A -0.1815
307 S A 0.1725
308 P A 0.7028
309 V A 2.0559
310 V A 2.0145
311 S A 0.5164
312 G A -0.7416
313 D A -1.9236
314 T A -1.3133
315 S A -1.4557
316 P A -1.4851
317 R A -2.1942
318 H A -1.4572
319 L A 0.4037
320 S A -0.1217
321 N A -0.3345
322 V A 1.1280
323 S A 0.0839
324 S A -0.2280
325 T A -0.0577
326 G A -0.4049
327 S A 0.1414
328 I A 1.4519
329 D A -0.1634
330 M A 0.9407
331 V A 1.0353
332 D A -1.1980
333 S A -0.6322
334 P A -0.4261
335 Q A -0.3808
336 L A 0.9521
337 A A 0.0851
338 T A -0.2151
339 L A 0.6626
340 A A -0.0024
341 D A -1.4836
342 E A -1.1911
343 V A 0.7914
344 S A -0.1185
345 A A -0.8347
346 S A -0.5809
347 L A 0.2834
348 A A -0.4318
349 K A -1.8821
350 Q A -1.4292
351 G A -0.6036
352 L A 0.9253
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6328 4.234 View CSV PDB
4.5 -0.7303 4.1668 View CSV PDB
5.0 -0.8419 4.1249 View CSV PDB
5.5 -0.9412 4.1249 View CSV PDB
6.0 -1.0013 4.1249 View CSV PDB
6.5 -1.0095 4.1249 View CSV PDB
7.0 -0.9757 4.1249 View CSV PDB
7.5 -0.9194 4.1249 View CSV PDB
8.0 -0.8515 4.1249 View CSV PDB
8.5 -0.772 4.1249 View CSV PDB
9.0 -0.6772 4.1249 View CSV PDB