Project name: 3cb1d111b635f53

Status: done

Started: 2026-07-15 06:02:42
Chain sequence(s) A: EVQLVESGGGCVKPGGSLRLSCSASGFSLTKYKMTWVRQAPGKGLEWVSSISSTSRDIDYADSVKGRFTISRDNAKNSLFLQMSSLRVDDTAVYYCTRDGWLWGWDVRSNYYYNALDVWGQGTCVTVSS
B: DIVVTQSPSSLSASVGDRVTITCRASQGIYNSIAWYQQKCGKAPKLLLYSTSTLLSGVPSRFSGSGSGTDYTLTITNLQCEDFATYYCQQYFVTPETFGQGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:34)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3cb1d111b635f53/tmp/folded.pdb                (00:03:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:43)
Show buried residues

Minimal score value
-2.8162
Maximal score value
1.5733
Average score
-0.4875
Total score value
-115.0408

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.0077
2 V A -1.0186
3 Q A -1.2771
4 L A 0.0000
5 V A 0.9144
6 E A 0.0000
7 S A -0.2644
8 G A -0.7844
9 G A -0.1861
10 G A 0.1306
11 C A 0.4664
12 V A -0.4475
13 K A -1.7644
14 P A -1.5687
15 G A -1.2807
16 G A -1.0821
17 S A -1.0355
18 L A -0.6361
19 R A -1.5004
20 L A 0.0000
21 S A -0.2760
22 C A 0.0000
23 S A -0.2102
24 A A 0.0000
25 S A -0.8207
26 G A -1.1659
27 F A -0.6699
28 S A -0.8148
29 L A 0.0000
30 T A -1.3320
31 K A -1.7220
32 Y A -0.6113
33 K A -0.3637
34 M A 0.0000
35 T A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6976
40 A A -1.0720
41 P A -0.9037
42 G A -1.4501
43 K A -2.3830
44 G A -1.6360
45 L A 0.0000
46 E A -1.0538
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -0.9612
53 S A -1.2293
54 T A -1.2032
55 S A -1.2345
56 R A -2.0485
57 D A -1.4306
58 I A 0.0511
59 D A -0.5383
60 Y A -0.9517
61 A A -1.7450
62 D A -2.7435
63 S A -1.6861
64 V A 0.0000
65 K A -2.6986
66 G A -1.7077
67 R A -1.3961
68 F A 0.0000
69 T A -0.6444
70 I A 0.0000
71 S A -0.1861
72 R A -0.8414
73 D A -1.3700
74 N A -1.6891
75 A A -1.2866
76 K A -2.1697
77 N A -1.4919
78 S A 0.0000
79 L A 0.0000
80 F A -0.3580
81 L A 0.0000
82 Q A -0.9865
83 M A 0.0000
84 S A -1.0083
85 S A -1.2166
86 L A 0.0000
87 R A -1.8464
88 V A -0.1828
89 D A -1.3095
90 D A 0.0000
91 T A -0.0888
92 A A 0.0000
93 V A 0.5194
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 T A 0.0000
98 R A -0.2063
99 D A 0.0000
100 G A 0.0000
101 W A 1.2831
102 L A 0.8872
103 W A 1.2471
104 G A 1.4900
105 W A 1.4649
106 D A 0.6441
107 V A 0.9414
108 R A -1.0726
109 S A -0.3594
110 N A -0.1143
111 Y A 1.5733
112 Y A 1.5181
113 Y A 0.0000
114 N A 0.4798
115 A A 0.0000
116 L A 0.0000
117 D A -0.4886
118 V A -0.4561
119 W A -0.4556
120 G A 0.0000
121 Q A -1.2800
122 G A 0.0000
123 T A 0.2591
124 C A 0.6882
125 V A 0.0000
126 T A 0.1014
127 V A 0.0000
128 S A -0.5601
129 S A -0.6619
1 D B -1.4771
2 I B 0.0000
3 V B 0.8966
4 V B 0.0000
5 T B -0.6913
6 Q B 0.0000
7 S B -0.7804
8 P B -0.5589
9 S B -0.7739
10 S B -0.8290
11 L B -0.6730
12 S B -1.0107
13 A B 0.0000
14 S B -0.6265
15 V B 0.3395
16 G B -1.0564
17 D B -1.8521
18 R B -2.5201
19 V B 0.0000
20 T B -0.4943
21 I B 0.0000
22 T B -0.9033
23 C B 0.0000
24 R B -2.2734
25 A B 0.0000
26 S B -0.7576
27 Q B -1.0475
28 G B -0.6839
29 I B 0.0000
30 Y B 0.9136
31 N B -0.2018
32 S B 0.0000
33 I B 0.0000
34 A B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B -1.5080
39 K B -2.0952
40 C B -0.6262
41 G B -1.4396
42 K B -2.6363
43 A B -1.7759
44 P B 0.0000
45 K B -1.9597
46 L B 0.0000
47 L B 0.0000
48 L B 0.0000
49 Y B 0.2419
50 S B 0.1287
51 T B 0.0000
52 S B -0.2580
53 T B 0.1883
54 L B 0.4589
55 L B 0.1918
56 S B -0.1189
57 G B -0.3582
58 V B -0.1758
59 P B -0.2511
60 S B -0.3473
61 R B -1.0291
62 F B 0.0000
63 S B -0.3190
64 G B -0.3026
65 S B -0.8329
66 G B -1.2212
67 S B -1.0008
68 G B -0.8957
69 T B -1.6994
70 D B -2.8162
71 Y B 0.0000
72 T B -0.8789
73 L B 0.0000
74 T B -0.5748
75 I B 0.0000
76 T B -1.7545
77 N B -2.1066
78 L B 0.0000
79 Q B -0.6660
80 C B -0.1413
81 E B -1.3911
82 D B 0.0000
83 F B -0.6723
84 A B 0.0000
85 T B -0.8531
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 Y B 0.0000
92 F B 1.2075
93 V B 0.9305
94 T B 0.0542
95 P B -0.5250
96 E B 0.0000
97 T B 0.0358
98 F B -0.0017
99 G B 0.0000
100 Q B -1.7213
101 G B 0.0000
102 T B 0.0000
103 K B -1.3804
104 L B 0.0000
105 E B -1.5139
106 I B -0.8541
107 K B -1.4327
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5952 3.7367 View CSV PDB
4.5 -0.6321 3.7213 View CSV PDB
5.0 -0.6719 3.7059 View CSV PDB
5.5 -0.7066 3.6909 View CSV PDB
6.0 -0.7277 3.6772 View CSV PDB
6.5 -0.7305 3.6659 View CSV PDB
7.0 -0.7174 3.6577 View CSV PDB
7.5 -0.6943 3.6531 View CSV PDB
8.0 -0.6647 3.653 View CSV PDB
8.5 -0.6287 3.6571 View CSV PDB
9.0 -0.5858 3.6637 View CSV PDB