Project name: SpaceHex_mut1_AB

Status: done

Started: 2026-05-05 10:04:05
Chain sequence(s) A: SSNAIGAIQTKGTGAAIAAADAMVKAANVTLTSADTTGDGNVVVYVTGEVGAVKAATEAGAETASQDGELVAVYVTPRPHSELGAKRSVSS
B: SSNAIGIIITKGTVAADAAADAMVKAANVTDTIIDTTGDGNVLVLVTGEVGAVKAATEAGAETASQVGELLIVIVLPRPHSELGAVFSVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:12)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:12)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:12)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:12)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:44)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3ece7cc34fcb286/tmp/folded.pdb                (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:19)
Show buried residues

Minimal score value
-2.9481
Maximal score value
1.7759
Average score
-0.8041
Total score value
-146.3372

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
2 S A -1.0460
3 S A -1.3834
4 N A -1.2180
5 A A 0.0000
6 I A 0.0000
7 G A 0.0000
8 A A 0.6877
9 I A 0.0000
10 Q A -0.0637
11 T A 0.0000
12 K A -1.9081
13 G A 0.0000
14 T A 0.0000
15 G A 0.0000
16 A A 0.0000
17 A A 0.0000
18 I A 0.0000
19 A A 0.0000
20 A A 0.0000
21 A A 0.0000
22 D A 0.0000
23 A A -0.9962
24 M A 0.0000
25 V A 0.0000
26 K A -1.9357
27 A A -1.2387
28 A A -1.4335
29 N A -1.9140
30 V A 0.0000
31 T A -0.7220
32 L A 0.0000
33 T A -0.1224
34 S A -0.3813
35 A A -0.7347
36 D A -1.7712
37 T A -1.4451
38 T A -1.0241
39 G A -1.9171
40 D A -2.8763
41 G A 0.0000
42 N A -1.8222
43 V A 0.0000
44 V A -0.3799
45 V A 0.0000
46 Y A 0.1725
47 V A 0.0000
48 T A -0.6527
49 G A -1.4907
50 E A -2.3023
51 V A -1.3462
52 G A -1.3032
53 A A -1.3676
54 V A 0.0000
55 K A -1.3475
56 A A -1.4936
57 A A 0.0000
58 T A 0.0000
59 E A -2.1030
60 A A -1.7620
61 G A 0.0000
62 A A -1.3545
63 E A -2.8185
64 T A -1.8867
65 A A 0.0000
66 S A -2.0096
67 Q A -2.2083
68 D A -1.2532
69 G A -1.5080
70 E A -2.3154
71 L A -0.8127
72 V A 0.3418
73 A A 0.9502
74 V A 1.7759
75 Y A 1.6780
76 V A 0.5743
77 T A -0.3863
78 P A -1.2188
79 R A -2.1783
80 P A -1.7211
81 H A -2.0146
82 S A -1.7923
83 E A -2.5964
84 L A -1.9036
85 G A -2.3038
86 A A -1.9124
87 K A -2.8659
88 R A -2.9481
89 S A -1.5762
90 V A -0.8100
91 S A -1.1574
92 S A -0.4268
2 S B -1.2758
3 S B -1.7341
4 N B -2.0381
5 A B 0.0000
6 I B 0.0000
7 G B 0.0000
8 I B 0.0000
9 I B 0.0000
10 I B 0.0000
11 T B 0.0000
12 K B -1.4914
13 G B -0.7920
14 T B -0.0310
15 V B 0.9721
16 A B 0.0000
17 A B 0.0000
18 D B -1.1689
19 A B -0.7511
20 A B 0.0000
21 A B -1.1702
22 D B -2.1380
23 A B -1.6756
24 M B 0.0000
25 V B -1.1346
26 K B -1.9009
27 A B -1.3229
28 A B -1.2761
29 N B -1.7382
30 V B 0.0000
31 T B -1.0154
32 D B -1.3544
33 T B -0.3089
34 I B 0.9561
35 I B 1.5690
36 D B 0.4991
37 T B -0.3197
38 T B 0.0000
39 G B -2.0486
40 D B -2.8551
41 G B -1.6313
42 N B 0.0000
43 V B 0.0000
44 L B 0.0000
45 V B 0.0000
46 L B 0.0000
47 V B 0.0000
48 T B 0.0000
49 G B -1.9558
50 E B -2.6043
51 V B -1.4646
52 G B -1.2784
53 A B -1.2364
54 V B 0.0000
55 K B -1.4089
56 A B -1.3988
57 A B 0.0000
58 T B 0.0000
59 E B -2.2352
60 A B -1.8953
61 G B 0.0000
62 A B -1.5104
63 E B -2.5141
64 T B -1.8230
65 A B 0.0000
66 S B -1.5610
67 Q B -1.4242
68 V B 0.1478
69 G B -0.5913
70 E B -1.8448
71 L B -0.6416
72 L B 0.0504
73 I B 0.0000
74 V B 0.8550
75 I B 0.6664
76 V B 0.1048
77 L B -0.4424
78 P B -1.3919
79 R B -2.3163
80 P B -1.7613
81 H B -1.7127
82 S B -1.6226
83 E B -1.7614
84 L B 0.0000
85 G B -0.9629
86 A B -0.5733
87 V B -0.3120
88 F B 0.0000
89 S B 0.0642
90 V B 0.0000
91 S B -0.7958
92 S B -0.7082
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6428 3.3777 View CSV PDB
4.5 -0.7221 3.2328 View CSV PDB
5.0 -0.8247 3.0624 View CSV PDB
5.5 -0.9335 2.8812 View CSV PDB
6.0 -1.0321 2.6962 View CSV PDB
6.5 -1.1058 2.5101 View CSV PDB
7.0 -1.1476 2.3244 View CSV PDB
7.5 -1.1647 2.1411 View CSV PDB
8.0 -1.1683 1.965 View CSV PDB
8.5 -1.1633 1.8078 View CSV PDB
9.0 -1.1492 1.7672 View CSV PDB