Project name: mi2699_2VY0_25C_conf2

Status: done

Started: 2026-05-22 14:58:33
Chain sequence(s) A: VPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:09:32)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/40212e7dc2f6994/tmp/folded.pdb                (00:09:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:15:14)
Show buried residues

Minimal score value
-3.6474
Maximal score value
1.6869
Average score
-0.665
Total score value
-174.901

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
35 V A 1.2289
36 P A -0.0607
37 E A -0.9837
38 V A -0.1565
39 I A -0.9204
40 E A -2.0796
41 I A -1.3228
42 D A -1.4408
43 G A -1.6736
44 K A -1.7537
45 Q A -1.5530
46 W A 0.0000
47 R A -1.2684
48 L A 0.2658
49 I A 1.4635
50 W A 0.0000
51 H A 0.0590
52 D A -0.9431
53 E A -0.9862
54 F A 0.0000
55 E A -2.5273
56 G A -2.0363
57 S A -1.5422
58 E A -2.3835
59 V A -1.9961
60 N A -2.7721
61 K A -3.2776
62 E A -2.9952
63 Y A -1.8192
64 W A 0.0000
65 T A -1.5165
66 F A 0.0000
67 E A -1.0199
68 K A -1.1081
69 G A 0.0000
70 N A 0.1787
71 G A 0.0000
72 I A 0.9974
73 A A 0.7269
74 Y A 1.6869
75 G A 0.9366
76 I A 1.1308
77 P A 0.3629
78 G A 0.0000
79 W A -0.0661
80 G A -0.9920
81 N A -1.4411
82 G A -0.9353
83 E A -0.6069
84 L A 0.3934
85 E A 0.0000
86 Y A 0.1785
87 Y A 0.0000
88 T A 0.0000
89 E A -2.4370
90 N A -2.0058
91 N A 0.0000
92 T A -0.8157
93 Y A 0.0609
94 I A -0.2559
95 V A -0.0711
96 N A -1.2695
97 G A -1.4232
98 T A 0.0000
99 L A 0.0000
100 V A 0.0000
101 I A 0.0000
102 E A 0.0000
103 A A 0.0000
104 R A -1.0552
105 K A -1.1107
106 E A -0.9571
107 I A 1.5342
108 I A 1.2367
109 T A 0.2025
110 D A -1.1825
111 P A -1.3540
112 N A -1.7062
113 E A -1.1834
114 G A -0.8724
115 T A 0.2591
116 F A 0.8380
117 L A 1.0020
118 Y A 0.0000
119 T A 0.0000
120 S A 0.0000
121 S A 0.0000
122 R A -0.8098
123 L A 0.0000
124 K A -0.5517
125 T A 0.0000
126 E A -1.2234
127 G A -1.5497
128 K A -2.2199
129 V A -1.3656
130 E A -1.8616
131 F A 0.0000
132 S A -1.3326
133 P A -1.0784
134 P A -0.4425
135 V A 0.0000
136 V A 0.0000
137 V A 0.0000
138 E A -0.4703
139 A A 0.0000
140 R A -0.8007
141 I A 0.0000
142 K A -1.3765
143 L A 0.0000
144 P A 0.0000
145 K A -2.7777
146 G A -1.9341
147 K A -2.3058
148 G A 0.0000
149 L A 0.0000
150 W A 0.1439
151 P A 0.0000
152 A A -0.0827
153 F A 0.0000
154 W A -0.0318
155 M A 0.0000
156 L A 0.0000
157 G A 0.0000
158 S A -1.2462
159 N A -1.2962
160 I A -1.0233
161 R A -2.3250
162 E A -2.2652
163 V A -0.4336
164 G A -0.3818
165 W A 0.4416
166 P A 0.0951
167 N A -1.0019
168 C A 0.0000
169 G A 0.0000
170 E A -0.3616
171 I A 0.0000
172 D A -0.3471
173 I A 0.0000
174 M A 0.0000
175 E A -0.3153
176 F A 0.0000
177 L A -0.3627
178 G A -1.5996
179 H A -2.0404
180 E A -1.8618
181 P A -1.8370
182 R A -1.4119
183 T A 0.0000
184 I A 0.0000
185 H A -0.6880
186 G A 0.0000
187 T A 0.0000
188 V A 0.0000
189 H A -0.8266
190 G A 0.0000
191 P A -0.9020
192 G A -1.0798
193 Y A 0.0000
194 S A -1.0727
195 G A -1.2336
196 S A -1.2651
197 K A -2.0190
198 G A -1.2602
199 I A -0.6895
200 T A -1.2244
201 R A -1.6924
202 A A -0.7079
203 Y A -0.2411
204 T A -0.7092
205 L A 0.0000
206 P A -1.1597
207 E A -2.1154
208 G A -1.2579
209 V A -0.8394
210 P A -1.2073
211 D A -1.8722
212 F A 0.0000
213 T A -2.1774
214 E A -2.7429
215 D A -1.7742
216 F A -0.7220
217 H A 0.0000
218 V A -0.7611
219 F A 0.0000
220 G A 0.0000
221 I A 0.0000
222 V A 0.0000
223 W A 0.0000
224 Y A -0.9802
225 P A -2.1143
226 D A -3.0778
227 K A -2.5905
228 I A 0.0000
229 K A -0.9893
230 W A 0.0000
231 Y A 0.0000
232 V A 0.0000
233 D A -1.9186
234 G A -1.0801
235 T A -0.4865
236 F A -0.1424
237 Y A -0.2068
238 H A -1.0458
239 E A -1.8747
240 V A 0.0000
241 T A -2.5906
242 K A -3.5635
243 E A -3.6474
244 Q A -2.5584
245 V A 0.0000
246 E A -3.2396
247 A A -1.7590
248 M A -0.8955
249 G A -1.4015
250 Y A -1.2243
251 E A -2.3449
252 W A 0.0000
253 V A 0.0000
254 F A 0.0000
255 D A -3.0645
256 K A -2.4945
257 P A -1.5817
258 F A 0.0000
259 Y A 0.0000
260 I A 0.0000
261 I A 0.0000
262 L A 0.0000
263 N A 0.0000
264 L A 0.0000
265 A A 0.2348
266 V A 0.0000
267 G A 0.0000
268 G A 0.2541
269 Y A 1.3336
270 W A 1.6366
271 P A 0.0000
272 G A -0.3519
273 N A -1.2740
274 P A -1.4610
275 D A -1.1572
276 A A -0.4630
277 T A -0.3931
278 T A 0.0000
279 P A -0.9516
280 F A -0.8315
281 P A -0.8919
282 A A 0.0000
283 K A -1.6712
284 M A 0.0000
285 V A -0.2206
286 V A 0.0000
287 D A -0.8549
288 Y A -0.5168
289 V A 0.0000
290 R A 0.0000
291 V A 0.0000
292 Y A 0.0000
293 S A 0.4934
294 F A 0.4628
295 V A 0.4145
296 S A -0.2065
297 G A -0.5925
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.2327 4.1381 View CSV PDB
4.5 -0.3022 4.1381 View CSV PDB
5.0 -0.3938 4.1381 View CSV PDB
5.5 -0.4908 4.1381 View CSV PDB
6.0 -0.5748 4.1381 View CSV PDB
6.5 -0.63 4.1381 View CSV PDB
7.0 -0.6511 4.1381 View CSV PDB
7.5 -0.6469 4.138 View CSV PDB
8.0 -0.6293 4.1378 View CSV PDB
8.5 -0.6047 4.1371 View CSV PDB
9.0 -0.5747 4.1348 View CSV PDB