Project name: Full 1QLX

Status: done

Started: 2026-04-17 00:57:40
Chain sequence(s) A: GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:15)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:28:33)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:28:34)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:28:34)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:28:35)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:28:36)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:28:36)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:28:37)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:28:38)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:28:39)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:28:39)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:28:40)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:28:41)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:28:41)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:28:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:28:45)
Show buried residues

Minimal score value
-3.5216
Maximal score value
2.2821
Average score
-0.8285
Total score value
-173.9894

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 G A -1.1092
2 S A -1.6414
3 K A -2.4489
4 K A -3.1603
5 R A -2.6838
6 P A -2.5666
7 K A -2.7621
8 P A -1.9614
9 G A -1.2435
10 G A -1.1715
11 W A 0.0000
12 N A -1.3570
13 T A -0.8368
14 G A -0.8326
15 G A -0.8847
16 S A -1.2020
17 R A -1.4489
18 Y A 0.0000
19 P A -1.0156
20 G A -1.1963
21 Q A -1.8423
22 G A -1.6030
23 S A -1.3661
24 P A -0.9661
25 G A -1.2458
26 G A -1.7076
27 N A -2.4213
28 R A -3.3434
29 Y A 0.0000
30 P A -1.5514
31 P A -1.8110
32 Q A -2.5344
33 G A -2.2005
34 G A -1.7214
35 G A -1.1820
36 G A -0.6367
37 W A -0.0336
38 G A -0.7006
39 Q A -1.5084
40 P A -1.2683
41 H A -1.8746
42 G A -1.2318
43 G A -1.0670
44 G A -0.4669
45 W A 0.1033
46 G A -0.4127
47 Q A -0.4993
48 P A -1.0043
49 H A -1.3356
50 G A -1.2786
51 G A -1.1449
52 G A -0.9014
53 W A -0.2243
54 G A -0.5241
55 Q A -0.9749
56 P A -1.0273
57 H A -1.4949
58 G A -1.0743
59 G A -0.9452
60 G A -0.5102
61 W A 0.0574
62 G A -0.7910
63 Q A -1.2528
64 P A -1.1610
65 H A -1.8055
66 G A -1.2221
67 G A -0.9727
68 G A -0.6613
69 W A -0.1538
70 G A -0.9339
71 Q A -1.6338
72 G A -1.4377
73 G A 0.0000
74 G A 0.0000
75 T A 0.0000
76 H A -0.8017
77 S A 0.0000
78 Q A -1.3366
79 W A -1.3389
80 N A -1.5537
81 K A -2.1915
82 P A -1.6225
83 S A -1.8811
84 K A -2.4612
85 P A -2.2961
86 K A -2.5495
87 T A -1.5390
88 N A -1.6306
89 M A -0.3156
90 K A -1.1206
91 H A -0.3127
92 M A 0.8011
93 A A 0.3564
94 G A 0.0341
95 A A -0.0334
96 A A 0.1997
97 A A 0.1112
98 A A 0.0074
99 G A 0.0062
100 A A 1.0902
101 V A 2.2821
102 V A 1.8813
103 G A 0.5784
104 G A 0.5689
105 L A 1.5816
106 G A 0.8615
107 G A 0.0850
108 Y A 0.0000
109 M A 0.1601
110 L A 0.2129
111 G A 0.0000
112 S A 0.2557
113 A A 0.0000
114 M A 0.9622
115 S A 0.3352
116 R A 0.0000
117 P A -0.1352
118 I A -0.4623
119 I A 0.0000
120 H A -1.3198
121 F A -0.8515
122 G A -1.2540
123 S A -1.3494
124 D A -2.4222
125 Y A -1.8420
126 E A 0.0000
127 D A 0.0000
128 R A -3.0400
129 Y A -2.0675
130 Y A 0.0000
131 R A -3.2884
132 E A -3.5216
133 N A 0.0000
134 M A -2.1013
135 H A -2.6521
136 R A -2.9520
137 Y A -1.4761
138 P A -0.8868
139 N A -0.5672
140 Q A -0.6765
141 V A 0.0000
142 Y A 0.0000
143 Y A 0.0000
144 R A -1.1867
145 P A -1.3881
146 M A -1.4753
147 D A -2.5975
148 E A -2.6243
149 Y A -1.5170
150 S A -1.3697
151 N A -1.4128
152 Q A 0.0000
153 N A -2.0221
154 N A -2.1446
155 F A 0.0000
156 V A 0.0000
157 H A -2.1449
158 D A -1.5928
159 C A 0.0000
160 V A 0.0000
161 N A -1.0602
162 I A -0.5828
163 T A 0.0000
164 I A -0.5805
165 K A -1.1827
166 Q A -0.3870
167 H A 0.0000
168 T A 0.2116
169 V A 1.1038
170 T A 0.2133
171 T A 0.0000
172 T A 0.0349
173 T A -0.4032
174 K A -1.3278
175 G A -1.0977
176 E A 0.0000
177 N A -1.1217
178 F A 0.1069
179 T A 0.0000
180 E A -0.6237
181 T A 0.0000
182 D A 0.0000
183 V A 0.1378
184 K A -0.6625
185 M A 0.0000
186 M A 0.0000
187 E A -0.8192
188 R A -0.9912
189 V A 0.0000
190 V A 0.0000
191 E A 0.0000
192 Q A -0.4314
193 M A 0.0000
194 C A 0.0000
195 I A 0.0000
196 T A 0.0000
197 Q A 0.0000
198 Y A 0.0000
199 E A 0.0000
200 R A 0.0000
201 E A 0.0000
202 S A 0.0000
203 Q A -1.1321
204 A A -0.7227
205 Y A 0.0000
206 Y A -1.1252
207 Q A -1.9901
208 R A -2.5188
209 G A -1.7442
210 S A -1.3141
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.8285 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.8285 View CSV PDB
model_4 -0.8816 View CSV PDB
model_2 -0.9069 View CSV PDB
model_11 -0.907 View CSV PDB
model_10 -0.9142 View CSV PDB
CABS_average -0.9205 View CSV PDB
model_6 -0.9215 View CSV PDB
model_7 -0.922 View CSV PDB
model_0 -0.9255 View CSV PDB
model_5 -0.9339 View CSV PDB
model_8 -0.9387 View CSV PDB
model_1 -0.9409 View CSV PDB
model_9 -1.0249 View CSV PDB
input -1.0667 View CSV PDB