Project name: 40c39f57b09e856

Status: done

Started: 2026-02-24 18:41:33
Chain sequence(s) A: EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYYMGWVRQAPGKGLEWVSGISPSSGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCVAHLHGAQGANPAWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRSGLHTFGQGTKLEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/40c39f57b09e856/tmp/folded.pdb                (00:01:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:18)
Show buried residues

Minimal score value
-2.8106
Maximal score value
1.5827
Average score
-0.6304
Total score value
-152.5473

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7377
2 V A -0.5764
3 Q A -0.7782
4 L A 0.0000
5 L A 0.6378
6 E A 0.1165
7 S A -0.3375
8 G A -0.7831
9 G A -0.0531
10 G A 0.6372
11 L A 1.4024
12 V A -0.0434
13 Q A -1.4043
14 P A -1.6575
15 G A -1.3887
16 G A -0.9446
17 S A -1.2465
18 L A -1.0883
19 R A -2.1148
20 L A 0.0000
21 S A -0.4297
22 C A 0.0000
23 A A -0.1828
24 A A 0.0000
25 S A -0.7513
26 G A -0.9089
27 F A -0.1054
28 T A 0.2925
29 F A 0.0000
30 S A 0.2088
31 Y A 1.3161
32 Y A 0.9103
33 Y A 0.5745
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6904
40 A A -1.0939
41 P A -1.2181
42 G A -1.4573
43 K A -2.3512
44 G A -1.5546
45 L A 0.0000
46 E A -0.9872
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 G A 0.0000
51 I A 0.0000
52 S A 0.0000
53 P A 0.2272
54 S A -0.1588
55 S A -0.3129
56 G A -0.0112
57 Y A 1.0504
58 T A 0.7084
59 Y A 0.3596
60 Y A -0.5992
61 A A 0.0000
62 D A -2.8106
63 S A -1.9027
64 V A 0.0000
65 K A -2.4481
66 G A -1.6287
67 R A 0.0000
68 F A 0.0000
69 T A -0.6695
70 I A 0.0000
71 S A -0.3299
72 R A -0.9395
73 D A -1.5819
74 N A -1.6398
75 S A -1.6456
76 K A -2.4116
77 N A -1.7833
78 T A -1.0117
79 L A 0.0000
80 Y A -0.2964
81 L A 0.0000
82 Q A -1.0762
83 M A 0.0000
84 N A -1.3452
85 S A -1.2004
86 L A 0.0000
87 R A -2.3887
88 A A -1.8117
89 E A -2.3303
90 D A 0.0000
91 T A -0.4027
92 A A 0.0000
93 V A 0.5111
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 V A 0.0000
98 A A 0.0000
99 H A -0.0960
100 L A -0.0251
101 H A -1.0600
102 G A -1.2518
103 A A -0.9994
104 Q A -1.2956
105 G A -0.9897
106 A A -0.9630
107 N A -1.4804
108 P A -0.5753
109 A A -0.5151
110 W A -0.4744
111 G A 0.0000
112 Q A -1.5408
113 G A -0.5201
114 T A 0.3635
115 L A 1.5827
116 V A 0.0000
117 T A 0.3147
118 V A 0.0000
119 S A -0.8575
120 S A -1.3781
121 G A -1.2538
122 G A -1.1254
123 G A -1.1675
124 G A -1.1635
125 S A -0.9982
126 G A -1.2879
127 G A -1.1731
128 G A -1.4129
129 G A -1.1792
130 S A -1.0426
131 G A -1.5016
132 G A -1.7594
133 G A -1.5301
134 G A -1.7722
135 S A -1.3355
136 D A -1.8710
137 I A 0.0000
138 Q A -2.0524
139 M A 0.0000
140 T A -1.3921
141 Q A 0.0000
142 S A -0.8605
143 P A -0.6485
144 S A -0.9740
145 S A -1.2748
146 L A -0.8171
147 S A -1.0240
148 A A 0.0000
149 S A -0.2993
150 V A 0.4114
151 G A -0.6151
152 D A -1.4085
153 R A -2.1620
154 V A 0.0000
155 T A -0.5770
156 I A 0.0000
157 T A -0.7893
158 C A 0.0000
159 R A -2.7445
160 A A 0.0000
161 S A -1.8020
162 Q A -1.8588
163 S A -1.3479
164 I A 0.0000
165 S A -0.7164
166 S A -0.5374
167 Y A -0.5844
168 L A 0.0000
169 N A -0.2443
170 W A 0.0000
171 Y A 0.0000
172 Q A 0.0000
173 Q A 0.0000
174 K A -1.6248
175 P A -1.2047
176 G A -1.6716
177 K A -2.6509
178 A A -1.7757
179 P A 0.0000
180 K A -1.8873
181 L A 0.0000
182 L A 0.0000
183 I A 0.0000
184 Y A -0.2828
185 A A -0.3283
186 A A 0.0000
187 S A -0.3432
188 S A -0.1963
189 L A 0.0459
190 Q A -0.6111
191 S A -0.5751
192 G A -0.5413
193 V A -0.4437
194 P A -0.4340
195 S A -0.4904
196 R A -0.7841
197 F A 0.0000
198 S A -0.3503
199 G A -0.3338
200 S A -0.7097
201 G A -1.1085
202 S A -1.0081
203 G A -1.1006
204 T A -1.6811
205 D A -2.1033
206 F A 0.0000
207 T A -0.7720
208 L A 0.0000
209 T A -0.5956
210 I A 0.0000
211 S A -1.2257
212 S A -1.0876
213 L A 0.0000
214 Q A -0.9792
215 P A -0.9086
216 E A -1.9461
217 D A 0.0000
218 F A -0.8456
219 A A 0.0000
220 T A -1.2146
221 Y A 0.0000
222 Y A 0.0000
223 C A 0.0000
224 Q A 0.0000
225 Q A 0.0000
226 S A -0.9327
227 R A -1.5372
228 S A -0.8638
229 G A -0.4214
230 L A -0.1879
231 H A 0.0000
232 T A -0.7469
233 F A -0.4670
234 G A 0.0000
235 Q A -1.6074
236 G A 0.0000
237 T A 0.0000
238 K A -2.3058
239 L A 0.0000
240 E A -1.6432
241 I A 0.3641
242 K A -1.1054
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6904 2.0837 View CSV PDB
4.5 -0.7159 2.08 View CSV PDB
5.0 -0.7453 2.0747 View CSV PDB
5.5 -0.7718 2.0685 View CSV PDB
6.0 -0.7877 2.0626 View CSV PDB
6.5 -0.7878 2.0578 View CSV PDB
7.0 -0.7737 2.0548 View CSV PDB
7.5 -0.7513 2.0535 View CSV PDB
8.0 -0.7246 2.053 View CSV PDB
8.5 -0.6944 2.0528 View CSV PDB
9.0 -0.661 2.0528 View CSV PDB