Project name: 7JTL_YIDI_dimer_L84S_mutagenesis

Status: done

Started: 2026-03-26 12:00:19
Chain sequence(s) A: QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDESKSPIQYIDIGNYTVSCSPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
B: QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEASPIQYIDIGNYTVSCSPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:21)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/435795bdf82bee2/tmp/folded.pdb                (00:02:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:36)
Show buried residues

Minimal score value
-2.905
Maximal score value
2.4006
Average score
-0.4181
Total score value
-84.8762

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
18 Q A -2.1900
19 E A -2.5740
20 C A -0.6954
21 S A -0.2769
22 L A 0.9446
23 Q A 0.1353
24 S A -0.1478
25 C A 0.0000
26 T A -0.3443
27 Q A -1.3909
28 H A -1.6328
29 Q A -1.8349
30 P A -0.6749
31 Y A 0.0422
32 V A 0.9505
33 V A 0.0000
34 D A -2.0244
35 D A -1.9883
36 P A -1.2459
37 C A -0.2321
38 P A 0.8513
39 I A 1.8672
40 H A 0.9436
41 F A 1.9121
42 Y A 0.9636
43 S A -0.3137
44 K A -0.9923
45 W A 0.0000
46 Y A 0.0000
47 I A 0.0000
48 R A -1.2846
49 V A -1.0221
50 G A -1.5652
51 A A -1.8392
52 R A -2.9050
53 K A -2.7910
54 S A -1.7194
55 A A -1.3968
56 P A -0.8859
57 L A -0.6390
58 I A -0.0466
59 E A -0.9719
60 L A 0.0000
61 C A 0.2499
62 V A -0.0335
63 D A -2.0055
64 E A -2.5024
67 S A -1.9022
68 K A -1.9586
69 S A -0.7891
70 P A -0.5184
71 I A 0.4124
72 Q A 0.2873
73 Y A 0.4217
74 I A 0.1266
75 D A -0.4640
76 I A 0.0000
77 G A -1.0961
78 N A -1.0503
79 Y A 0.0000
80 T A 0.1856
81 V A 0.5986
82 S A 0.6784
83 C A 1.1180
84 S A 0.2865
85 P A -0.0720
86 F A 0.0000
87 T A 0.0000
88 I A 0.0000
89 N A -0.8944
90 C A 0.0000
91 Q A -1.6097
92 E A -1.7167
93 P A 0.0000
94 K A -2.0817
95 L A -0.8560
96 G A -1.1240
97 S A 0.0000
98 L A 0.0000
99 V A 0.0000
100 V A 0.0000
101 R A -0.6881
102 C A 0.0000
103 S A 0.0000
104 F A 2.0911
105 Y A 0.6092
106 E A -1.4686
107 D A -1.6119
108 F A -0.1010
109 L A 0.5660
110 E A -0.5227
111 Y A 0.7166
112 H A -0.6113
113 D A -1.4013
114 V A 0.0000
115 R A -1.2936
116 V A 0.0000
117 V A 0.1029
118 L A 0.0000
119 D A -0.9714
120 F A 0.2535
121 I A 1.6469
18 Q B -2.2867
19 E B -2.5203
20 C B -0.5578
21 S B -0.0493
22 L B 0.9483
23 Q B -0.0295
24 S B -0.1364
25 C B 0.0000
26 T B -0.3714
27 Q B -1.2209
28 H B -1.6919
29 Q B -1.7964
30 P B -0.5948
31 Y B 0.0988
32 V B 1.0343
33 V B 0.0000
34 D B -1.9517
35 D B -1.9126
36 P B -1.0650
37 C B 0.0107
38 P B 1.0337
39 I B 1.8900
40 H B 1.0533
41 F B 2.1103
42 Y B 1.5630
43 S B 0.2140
44 K B -0.5436
45 W B 0.0000
46 Y B -0.2055
47 I B 0.0000
48 R B -0.9368
49 V B -0.7183
50 G B -1.2565
51 A B -1.7249
52 R B -2.7826
53 K B -2.7242
54 S B -1.6461
55 A B -1.2968
56 P B -0.6896
57 L B -0.2871
58 I B 0.3767
59 E B -0.0068
60 L B 0.0000
61 C B -0.2280
62 V B -0.9714
63 D B -2.4163
64 E B -2.5353
65 A B -1.1765
69 S B -0.8520
70 P B -0.4662
71 I B -0.4992
72 Q B -0.3676
73 Y B 0.3152
74 I B 0.8918
75 D B -0.0772
76 I B 0.0000
77 G B 0.0000
78 N B -1.0884
79 Y B 0.0000
80 T B 0.1847
81 V B 0.6783
82 S B 0.7322
83 C B 0.6939
84 S B 0.2791
85 P B -0.0557
86 F B 0.0000
87 T B 0.0000
88 I B 0.0000
89 N B -0.7434
90 C B 0.0000
91 Q B -1.3718
92 E B -1.2586
93 P B -1.2055
94 K B -1.9559
95 L B -0.7518
96 G B -0.8193
97 S B -1.0579
98 L B 0.0000
99 V B 0.0000
100 V B 0.0000
101 R B -0.6290
102 C B 0.0000
103 S B 0.0000
104 F B 2.4006
105 Y B 0.9991
106 E B -1.2479
107 D B -1.5324
108 F B -0.0689
109 L B 0.5548
110 E B -0.6304
111 Y B 0.5778
112 H B -0.7486
113 D B -1.4788
114 V B 0.0000
115 R B -1.5140
116 V B 0.0000
117 V B 0.1443
118 L B 0.0000
119 D B -0.9086
120 F B 0.3144
121 I B 1.6928
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.2002 5.3534 View CSV PDB
4.5 0.1044 5.173 View CSV PDB
5.0 -0.0115 4.9624 View CSV PDB
5.5 -0.1298 4.7609 View CSV PDB
6.0 -0.2321 4.5998 View CSV PDB
6.5 -0.3065 4.4862 View CSV PDB
7.0 -0.3533 4.406 View CSV PDB
7.5 -0.3823 4.3433 View CSV PDB
8.0 -0.4005 4.2933 View CSV PDB
8.5 -0.4076 4.2585 View CSV PDB
9.0 -0.402 4.2373 View CSV PDB