Project name: AAVA_R4

Status: done

Started: 2026-08-21 04:29:02
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/44e628881ec97af/tmp/folded.pdb                (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:31)
Show buried residues

Minimal score value
-2.632
Maximal score value
2.0545
Average score
-0.5395
Total score value
-133.7862

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4783
2 V A -1.0361
3 Q A -1.4840
4 L A 0.0000
5 Q A -1.7503
6 E A 0.0000
7 S A -0.7067
8 G A -0.4214
9 P A -0.0468
10 G A 0.2549
11 L A 0.7935
12 V A 0.0000
13 K A -1.4767
14 P A -1.1660
15 S A -1.3121
16 Q A -1.7965
17 T A -1.4840
18 L A 0.0000
19 S A -0.8689
20 L A 0.0000
21 T A -0.5912
22 A A 0.0000
23 T A -1.1713
24 V A 0.0000
25 S A -1.1682
26 G A -1.2173
27 G A -0.9632
28 S A -0.6840
29 I A 0.0000
30 S A -0.2344
31 S A -0.3024
32 G A -0.1436
33 D A 0.1638
34 Y A 0.7012
35 Y A 0.6043
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6512
43 P A -0.6882
44 G A -1.1479
45 C A -1.2532
46 K A -2.0446
47 G A -1.2591
48 L A 0.0000
49 E A -0.7803
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1131
54 I A 0.0000
55 Y A 0.3412
56 Y A 0.3644
57 S A -0.0661
58 G A -0.2040
59 S A -0.2645
60 T A -0.2882
61 D A -0.7902
62 Y A -0.7496
63 N A -0.9914
64 P A -1.1554
65 S A -0.8520
66 L A 0.0000
67 K A -2.1054
68 S A -1.4134
69 R A -1.6110
70 V A 0.0000
71 T A -1.0156
72 M A 0.0000
73 S A -0.3562
74 V A -0.3647
75 D A -1.2127
76 T A -1.0112
77 S A -1.3324
78 K A -2.1756
79 N A -1.4399
80 Q A -1.2626
81 F A 0.0000
82 S A -0.4893
83 L A 0.0000
84 K A -1.3565
85 V A 0.0000
86 N A -1.7121
87 S A -1.4594
88 V A 0.0000
89 T A -0.6104
90 A A -0.1940
91 A A 0.0301
92 D A 0.0000
93 T A 0.2587
94 A A 0.0000
95 V A 0.2281
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.5872
104 F A 2.0545
105 G A 0.6802
106 V A 0.7386
107 G A 0.7868
108 T A 0.0000
109 F A 0.0000
110 D A -0.3531
111 Y A -0.2685
112 W A -0.6652
113 G A 0.0000
114 Q A -1.5908
115 G A -0.7660
116 T A -0.1845
117 L A 0.8148
118 V A 0.0000
119 T A 0.3143
120 V A 0.0000
121 S A -0.2778
122 S A -0.5532
123 A A -0.5756
124 A A -0.3458
125 G A -0.8316
126 G A -1.0609
127 G A -1.1090
128 G A -1.1339
129 S A -0.9325
130 G A -1.1631
131 G A -1.1920
132 G A -1.1317
133 G A -1.1543
134 S A -0.9469
135 G A -1.0814
136 G A -1.3176
137 G A -1.2552
138 G A -1.2524
139 S A -1.1303
140 D A -1.3487
141 I A -0.3476
142 V A 0.8568
143 M A 0.0000
144 T A -0.5710
145 Q A -0.6486
146 S A -0.7277
147 P A -0.3498
148 A A -0.3752
149 T A -0.5177
150 L A -0.2595
151 S A -0.4007
152 L A -0.6828
153 S A -0.9777
154 P A -1.4792
155 G A -1.8158
156 E A -2.4242
157 R A -2.6320
158 A A 0.0000
159 T A -0.6481
160 L A 0.0000
161 S A -0.8900
162 V A 0.0000
163 R A -2.3228
164 A A 0.0000
165 S A -0.9298
166 Q A -1.6374
167 S A -1.2502
168 V A 0.0000
169 S A -0.5297
170 S A -0.1475
171 Y A 0.6386
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5490
179 P A -0.9121
180 G A -1.0041
181 C A -1.1758
182 Q A -1.6574
183 A A -1.2333
184 P A 0.0000
185 R A -1.5700
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.3576
190 D A -0.5011
191 A A 0.0000
192 S A -0.9578
193 N A -1.3602
194 R A -1.5168
195 A A -0.9750
196 T A -0.6713
197 G A -0.6690
198 I A 0.0000
199 P A -0.4596
200 A A -0.4094
201 R A -0.7637
202 F A 0.0000
203 S A -0.7131
204 G A -0.7340
205 S A -0.8338
206 G A -1.1840
207 S A -0.8015
208 G A -1.0886
209 T A -1.7784
210 D A -2.2003
211 F A 0.0000
212 T A -0.7859
213 L A 0.0000
214 T A -0.6225
215 I A 0.0000
216 S A -1.4827
217 S A -1.7926
218 L A 0.0000
219 E A -2.0214
220 P A -1.4534
221 E A -2.2959
222 D A 0.0000
223 F A -0.7512
224 A A 0.0000
225 V A -0.6873
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1545
233 S A -0.3428
234 T A -0.5098
235 P A -0.6205
236 L A 0.0000
237 T A 0.0172
238 F A 0.2363
239 G A 0.0000
240 G A -0.8318
241 G A -0.8137
242 T A 0.0000
243 K A -0.9425
244 A A 0.0000
245 E A -0.5546
246 I A 0.6570
247 K A -0.9153
248 A A -0.3678
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4907 4.9162 View CSV PDB
4.5 -0.5123 4.9145 View CSV PDB
5.0 -0.5372 4.9096 View CSV PDB
5.5 -0.5599 4.898 View CSV PDB
6.0 -0.5739 4.8767 View CSV PDB
6.5 -0.5751 4.8475 View CSV PDB
7.0 -0.5639 4.8143 View CSV PDB
7.5 -0.5446 4.7796 View CSV PDB
8.0 -0.5208 4.7444 View CSV PDB
8.5 -0.4938 4.709 View CSV PDB
9.0 -0.4639 4.6737 View CSV PDB