Project name: HSA7A10_prot3D_74_015M

Status: done

Started: 2026-02-25 09:16:06
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQSYDSSLGGWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAQGNALADVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/4674ede805b787f/tmp/folded.pdb                (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:06)
Show buried residues

Minimal score value
-2.8567
Maximal score value
1.507
Average score
-0.5357
Total score value
-122.6844

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.7716
2 S A 0.3481
3 V A 1.3776
4 L A 0.0000
5 T A 0.0976
6 Q A 0.0000
7 P A -0.3990
8 P A -0.5840
9 S A -0.4534
11 V A -0.0421
12 S A -0.1459
13 G A 0.0000
14 A A -0.1964
15 P A -0.9187
16 G A -1.7774
17 Q A -2.5072
18 R A -2.6685
19 V A 0.0000
20 T A -0.5160
21 I A 0.0000
22 S A -0.3368
23 C A 0.0000
24 T A -0.1822
25 G A -0.0036
26 S A -0.1622
27 S A -0.6404
28 S A -0.3215
29 N A 0.0000
30 I A 0.0000
31 G A -0.8703
35 A A -0.5316
36 G A -0.6751
37 Y A -0.3497
38 D A -1.1953
39 V A 0.0000
40 H A -0.7207
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.4115
44 Q A 0.0000
45 L A 0.0402
46 P A -0.3165
47 G A -0.3383
48 T A -0.3396
49 A A -0.4455
50 P A 0.0000
51 K A -0.9675
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -0.8491
56 G A -1.1409
57 N A -1.2092
65 S A -1.2950
66 N A -1.6655
67 R A -1.9508
68 P A -1.0651
69 S A -0.7597
70 G A -0.7780
71 V A -0.7947
72 P A -1.2870
74 D A -2.1241
75 R A -1.5033
76 F A 0.0000
77 S A -0.9455
78 G A -0.7526
79 S A -0.8333
80 K A -1.1296
83 S A -0.7790
84 G A -0.8965
85 T A -0.6823
86 S A -0.6254
87 A A 0.0000
88 S A -0.4423
89 L A 0.0000
90 A A 0.0000
91 I A 0.0000
92 T A -1.8653
93 G A -1.7684
94 L A 0.0000
95 Q A -1.5089
96 A A -1.1917
97 E A -2.0928
98 D A 0.0000
99 E A -1.2869
100 A A 0.0000
101 D A -0.6121
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A -0.0991
106 S A 0.0000
107 Y A 0.1248
108 D A 0.0000
109 S A -0.2054
110 S A -0.2282
113 L A 0.0373
114 G A 0.2435
115 G A 0.0000
116 W A 0.4438
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4348
121 G A 0.0000
122 T A 0.0000
123 K A -0.6912
124 V A 0.0000
125 T A 0.1132
126 V A 0.3009
127 L A 1.4788
1 Q B -0.9391
2 V B 0.0953
3 Q B -0.4454
4 L B 0.0000
5 V B 0.8709
6 Q B 0.1169
7 S B -0.6334
8 G B -0.8819
9 G B -0.5731
11 G B 0.4220
12 V B 1.5070
13 V B 0.1259
14 Q B -1.6161
15 P B -2.3241
16 G B -2.2453
17 R B -2.8567
18 S B -1.9854
19 L B -1.2473
20 R B -2.0746
21 L B 0.0000
22 S B -0.4947
23 C B 0.0000
24 A B -0.1482
25 A B -0.1324
26 S B -0.3622
27 G B -0.3911
28 F B -0.0805
29 T B -0.4067
30 F B -0.2827
35 S B 0.2120
36 S B 0.5367
37 Y B 0.9701
38 G B 0.4888
39 M B 0.0000
40 H B -0.1482
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.7127
45 A B -1.0146
46 P B -0.9567
47 G B -1.4725
48 K B -2.2055
49 G B -1.4018
50 L B 0.0000
51 E B -0.5789
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.3960
58 Y B 0.6045
59 D B -1.4421
62 G B -0.7295
63 S B -0.7432
64 N B -0.5226
65 K B -0.5278
66 Y B 0.0738
67 Y B -0.5382
68 A B 0.0000
69 D B -2.4592
70 S B -1.9184
71 V B 0.0000
72 K B -2.4669
74 G B -1.7256
75 R B -1.6903
76 F B 0.0000
77 T B -0.7711
78 I B 0.0000
79 S B -0.7423
80 R B -1.2548
81 D B -1.6170
82 N B -1.6264
83 S B -1.5226
84 K B -2.2348
85 N B -1.4971
86 T B -0.9254
87 L B 0.0000
88 Y B -0.5193
89 L B 0.0000
90 Q B -1.1938
91 M B 0.0000
92 N B -2.2311
93 S B -2.0579
94 L B 0.0000
95 R B -2.8368
96 A B -1.7041
97 E B -1.8963
98 D B 0.0000
99 T B -0.3605
100 A B 0.0000
101 V B 0.2761
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B -0.3648
107 A B -0.5042
108 Q B -1.0681
109 G B -0.7872
110 N B -1.2219
113 A B -0.9777
114 L B -0.7658
115 A B -0.7008
116 D B -0.8181
117 V B -0.4231
118 W B 0.0000
119 G B 0.0000
120 Q B -0.9354
121 G B -0.4460
122 T B 0.0000
123 T B 0.0463
124 V B 0.0000
125 T B 0.3052
126 V B -0.7218
127 S B -0.4513
128 S B -0.5024
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4881 2.3111 View CSV PDB
4.5 -0.5184 2.292 View CSV PDB
5.0 -0.5519 2.2696 View CSV PDB
5.5 -0.5837 2.2474 View CSV PDB
6.0 -0.6087 2.2291 View CSV PDB
6.5 -0.6232 2.2174 View CSV PDB
7.0 -0.6283 2.2118 View CSV PDB
7.5 -0.6279 2.2098 View CSV PDB
8.0 -0.6241 2.2091 View CSV PDB
8.5 -0.6163 2.2089 View CSV PDB
9.0 -0.6029 2.2088 View CSV PDB