Project name: AAAV_R1

Status: done

Started: 2026-08-21 08:47:55
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:33)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/4749f27d5d8f497/tmp/folded.pdb                (00:01:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:56)
Show buried residues

Minimal score value
-2.5154
Maximal score value
1.8131
Average score
-0.5415
Total score value
-134.2891

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6972
2 V A 0.0000
3 Q A -2.0666
4 L A 0.0000
5 Q A -1.8598
6 E A 0.0000
7 S A -0.6917
8 G A -0.3805
9 P A 0.0406
10 G A 0.3856
11 L A 0.9695
12 V A 0.0000
13 K A -1.8437
14 P A -1.3421
15 S A -1.4374
16 Q A -2.0009
17 T A -1.6350
18 L A 0.0000
19 S A -1.0068
20 L A 0.0000
21 T A -0.6943
22 A A 0.0000
23 T A -1.2548
24 V A 0.0000
25 S A -1.3912
26 G A -1.4172
27 G A -1.0870
28 S A -0.6311
29 I A 0.0000
30 S A -0.2632
31 S A -0.3822
32 G A -0.2493
33 D A -0.3602
34 Y A 0.4041
35 Y A 0.4614
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6997
43 P A -0.6708
44 G A -1.1391
45 C A -1.2336
46 K A -2.0409
47 G A -1.2326
48 L A 0.0000
49 E A -0.7421
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1763
54 I A 0.0000
55 Y A 0.3004
56 Y A 0.3191
57 S A -0.0778
58 G A -0.2240
59 S A -0.2429
60 T A -0.2215
61 D A -0.6617
62 Y A -0.6815
63 N A -0.9612
64 P A -1.2686
65 S A -1.1079
66 L A 0.0000
67 K A -2.0966
68 S A -1.4149
69 R A -1.6612
70 V A 0.0000
71 T A -1.1007
72 M A 0.0000
73 S A -0.3883
74 V A -0.3655
75 D A -1.2145
76 T A -1.0184
77 S A -1.3368
78 K A -2.1806
79 N A -1.4517
80 Q A -1.2797
81 F A 0.0000
82 S A -0.5723
83 L A 0.0000
84 K A -1.6355
85 V A 0.0000
86 N A -1.7473
87 S A -1.5458
88 V A 0.0000
89 T A -0.7301
90 A A -0.2966
91 A A -0.0347
92 D A 0.0000
93 T A 0.2874
94 A A 0.0000
95 V A 0.2350
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.2095
104 F A 1.8131
105 G A 0.6460
106 V A 0.8161
107 G A 0.7844
108 T A 0.0000
109 F A 0.0000
110 D A -0.5303
111 Y A -0.6382
112 W A -0.8557
113 G A 0.0000
114 Q A -1.6282
115 G A -0.7334
116 T A -0.1866
117 L A 0.8484
118 V A 0.0000
119 T A 0.3532
120 V A 0.0000
121 S A -0.3832
122 S A -0.7066
123 A A -0.6774
124 A A -0.3619
125 G A -0.8418
126 G A -1.0813
127 G A -1.1464
128 G A -1.1778
129 S A -1.0211
130 G A -1.1684
131 G A -1.1897
132 G A -1.1978
133 G A -1.2038
134 S A -1.0592
135 G A -1.1998
136 G A -1.1757
137 G A -1.2812
138 G A -1.2993
139 S A -1.2259
140 D A -1.3709
141 I A -0.3437
142 V A 0.8649
143 M A 0.0000
144 T A -0.5855
145 Q A -0.6540
146 S A -0.7207
147 P A -0.3596
148 A A -0.3737
149 T A -0.5138
150 L A -0.2062
151 S A -0.3104
152 L A -0.4938
153 S A -0.7809
154 P A -1.3177
155 G A -1.6280
156 E A -2.0475
157 R A -2.5154
158 A A 0.0000
159 T A -0.6302
160 L A 0.0000
161 S A -0.8847
162 A A 0.0000
163 R A -2.3546
164 A A 0.0000
165 S A -0.9498
166 Q A -1.6481
167 S A -1.2259
168 V A 0.0000
169 S A -0.4404
170 S A -0.1328
171 Y A 0.8149
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4843
179 P A -0.9746
180 G A -0.9651
181 C A -1.1080
182 Q A -1.4832
183 A A -1.1563
184 P A 0.0000
185 R A -1.4897
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2485
190 D A -0.3264
191 A A 0.0000
192 S A -0.9020
193 N A -1.2598
194 R A -1.5023
195 A A -0.9975
196 T A -0.6787
197 G A -0.6645
198 I A 0.0000
199 P A -0.4374
200 A A -0.3939
201 R A -0.7152
202 F A 0.0000
203 S A -0.6965
204 G A -0.7101
205 S A -0.7898
206 G A -1.1093
207 S A -0.9263
208 G A -1.0657
209 T A -1.7814
210 D A -2.2221
211 F A 0.0000
212 T A -0.7907
213 L A 0.0000
214 T A -0.6010
215 I A 0.0000
216 S A -1.2819
217 S A -1.6023
218 L A 0.0000
219 E A -2.1429
220 P A -1.4052
221 E A -2.2073
222 D A 0.0000
223 F A -0.6903
224 A A 0.0000
225 V A -0.6842
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.4001
232 G A 0.0725
233 S A -0.2402
234 T A -0.4236
235 P A -0.4477
236 L A 0.0834
237 T A 0.1444
238 F A 0.2974
239 G A 0.0000
240 G A -0.8274
241 G A -0.8085
242 T A 0.0000
243 K A -0.9639
244 A A 0.0000
245 E A -0.3999
246 I A 0.8375
247 K A -0.6056
248 A A -0.2148
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5012 4.7439 View CSV PDB
4.5 -0.5247 4.697 View CSV PDB
5.0 -0.5511 4.6381 View CSV PDB
5.5 -0.5747 4.574 View CSV PDB
6.0 -0.5893 4.508 View CSV PDB
6.5 -0.5906 4.4415 View CSV PDB
7.0 -0.5793 4.3749 View CSV PDB
7.5 -0.5598 4.3087 View CSV PDB
8.0 -0.5353 4.244 View CSV PDB
8.5 -0.5069 4.1837 View CSV PDB
9.0 -0.4746 4.1337 View CSV PDB