Project name: PrP Y163X truncation

Status: done

Started: 2026-04-20 19:43:45
Chain sequence(s) A: GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:08)
[INFO]       CABS:     Running CABS flex simulation                                                (00:01:54)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:16:54)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:16:54)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:16:54)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:16:55)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:16:55)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:16:55)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:16:56)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:16:56)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:16:57)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:16:57)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:16:57)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:16:58)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:16:58)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:17:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:17:03)
Show buried residues

Minimal score value
-3.1412
Maximal score value
2.8158
Average score
-0.7507
Total score value
-106.6031

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 G A -1.2717
2 S A -1.8511
3 K A -2.7739
4 K A 0.0000
5 R A -1.9070
6 P A -1.6596
7 K A -2.3772
8 P A 0.0000
9 G A -1.4049
10 G A -1.3280
11 W A -1.3420
12 N A -1.6125
13 T A -1.7084
14 G A -1.4778
15 G A -1.1449
16 S A -1.5149
17 R A -2.4266
18 Y A -1.9514
19 P A -1.8385
20 G A -2.0809
21 Q A -2.5182
22 G A -1.7604
23 S A -1.2509
24 P A -1.6024
25 G A -1.4312
26 G A -1.4373
27 N A -2.0739
28 R A -2.2953
29 Y A -0.7520
30 P A -0.6891
31 P A -1.2200
32 Q A -1.3843
33 G A -1.2600
34 G A -1.1328
35 G A -0.8526
36 G A -0.7084
37 W A -0.3540
38 G A -0.6173
39 Q A -0.8592
40 P A -1.0031
41 H A -1.4872
42 G A -1.1564
43 G A -0.8742
44 G A -1.0542
45 W A -0.6386
46 G A -0.7923
47 Q A -1.0349
48 P A -0.8485
49 H A -1.1636
50 G A -0.9201
51 G A -0.8023
52 G A -0.5567
53 W A 0.2057
54 G A -0.5748
55 Q A -1.1343
56 P A -1.1498
57 H A -1.7869
58 G A -1.4935
59 G A -1.2400
60 G A -0.7542
61 W A 0.1323
62 G A -0.5772
63 Q A -0.6339
64 P A -0.8585
65 H A -1.2940
66 G A -0.7390
67 G A -0.6694
68 G A -0.7138
69 W A -0.1947
70 G A -0.8252
71 Q A -1.6727
72 G A -1.5672
73 G A -1.2622
74 G A -1.2416
75 T A -1.2069
76 H A -1.6548
77 S A -1.5743
78 Q A -1.7598
79 W A -0.8043
80 N A -1.8824
81 K A -2.0064
82 P A -1.6182
83 S A -1.9949
84 K A -2.4535
85 P A -1.9390
86 K A -1.8752
87 T A -1.9791
88 N A -2.0994
89 M A -0.8876
90 K A -2.0056
91 H A -1.6452
92 M A -0.0409
93 A A -0.4499
94 G A -0.6295
95 A A -0.2600
96 A A 0.0963
97 A A 0.5165
98 A A 0.3557
99 G A 0.4525
100 A A 0.8033
101 V A 1.8134
102 V A 1.6211
103 G A 0.7707
104 G A 0.6357
105 L A 2.2879
106 G A 1.5543
107 G A 1.9551
108 Y A 2.7098
109 M A 2.8158
110 L A 2.8047
111 G A 1.2126
112 S A 0.6922
113 A A 1.3034
114 M A 1.7600
115 S A 0.4893
116 R A -0.3739
117 P A 1.0092
118 I A 2.6836
119 I A 2.3148
120 H A 0.6065
121 F A 1.2364
122 G A 0.3607
123 S A -0.7850
124 D A -1.1713
125 Y A -1.1006
126 E A -2.3514
127 D A -3.1412
128 R A -2.4590
129 Y A -1.6147
130 Y A -1.0567
131 R A -2.5179
132 E A -2.2730
133 N A -1.2926
134 M A -0.4451
135 H A -1.6231
136 R A -1.9532
137 Y A -0.2924
138 P A -0.6367
139 N A -1.0286
140 Q A 0.2055
141 V A 1.7218
142 Y A 1.7390
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.7507 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_7 -0.7507 View CSV PDB
model_2 -0.7695 View CSV PDB
model_5 -0.77 View CSV PDB
model_4 -0.785 View CSV PDB
model_10 -0.8036 View CSV PDB
model_3 -0.8356 View CSV PDB
CABS_average -0.8393 View CSV PDB
model_0 -0.8541 View CSV PDB
model_1 -0.8658 View CSV PDB
model_11 -0.8759 View CSV PDB
input -0.902 View CSV PDB
model_8 -0.9117 View CSV PDB
model_9 -0.9214 View CSV PDB
model_6 -0.9281 View CSV PDB