Project name: 490aa58bb8be2a1

Status: done

Started: 2026-07-18 03:07:42
Chain sequence(s) A: FKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVLILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWPVETCEERLL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:31)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/490aa58bb8be2a1/tmp/folded.pdb                (00:01:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:13)
Show buried residues

Minimal score value
-3.0657
Maximal score value
1.6858
Average score
-0.5916
Total score value
-121.2683

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
225 F A 0.1552
226 K A -0.2699
227 V A 0.0000
228 S A -0.0318
229 L A 0.0000
230 P A 0.1889
231 L A 0.9221
232 R A -0.2375
233 T A 0.0000
234 N A -1.1552
235 Y A 0.4245
236 L A 0.0000
237 Y A 0.2206
238 G A 0.0000
239 K A -1.1003
240 I A 0.0000
241 K A -2.9765
242 K A -2.3224
243 T A -1.3246
244 L A 0.0000
245 P A -1.2754
246 E A -1.7380
247 L A 0.0000
248 Y A 0.4034
249 A A -0.3236
250 F A 0.0000
251 T A 0.0000
252 I A 0.0000
253 C A 0.0000
254 L A 0.0000
255 W A 0.0000
256 L A 0.0000
257 R A -1.3538
258 S A 0.0000
259 S A -0.7543
260 A A -0.4427
261 S A -0.8758
262 P A -0.9609
263 G A 0.0000
264 I A 0.0000
265 G A 0.0000
266 T A 0.0000
267 P A 0.0000
268 F A 0.0000
269 S A 0.0000
270 Y A 0.0000
271 A A 0.0000
272 V A 0.0000
273 P A -0.5033
274 G A -0.7333
275 Q A -1.0678
276 A A -1.1828
277 N A -1.2527
278 E A 0.0000
279 I A 0.0000
280 V A 0.0000
281 L A 0.0000
282 I A 0.0000
283 E A -0.7343
284 W A -0.1487
285 G A -0.9310
286 N A -1.9060
287 N A -1.9979
288 P A -1.2287
289 I A 0.0000
290 E A -0.8948
291 L A 0.0000
292 L A 0.0000
293 I A 0.0000
294 N A -1.2260
295 D A -1.4100
296 K A -1.2695
297 V A 0.2773
298 A A -0.7043
299 Q A -1.2330
300 L A 0.0000
301 P A -0.0284
302 L A 0.0000
303 F A 1.6858
304 V A 0.0000
305 S A -0.7418
306 D A -1.6943
307 G A -1.8634
308 K A -1.8803
309 W A 0.0000
310 H A -0.5867
311 H A 0.0000
312 I A 0.0000
313 C A 0.0000
314 V A 0.0000
315 T A 0.0000
316 W A 0.0000
317 T A 0.0000
318 T A 0.0000
319 R A -2.4072
320 D A -3.0372
321 G A 0.0000
322 M A -1.9240
323 W A 0.0000
324 E A -0.6035
325 A A 0.0000
326 F A 0.0000
327 Q A -1.0904
328 D A -1.7474
329 G A -1.9370
330 E A -2.7497
331 K A -2.2692
332 L A -0.6667
333 G A -0.6135
334 T A -0.7133
335 G A -1.5950
336 E A -3.0657
337 N A -2.6949
338 L A 0.0000
339 A A 0.0000
340 P A -1.3595
341 W A 0.2172
342 H A 0.0247
343 P A -0.2198
344 I A 0.0000
345 K A -1.4253
346 P A -1.3949
347 G A -1.0511
348 G A 0.0000
349 V A -0.3278
350 L A 0.0000
351 I A 0.0000
352 L A 0.0000
353 G A 0.0000
354 Q A 0.0000
355 E A -1.2013
356 Q A 0.0000
357 D A -2.5051
358 T A -1.2703
359 V A -0.1698
360 G A -0.4414
361 G A -1.2649
362 R A -2.5614
363 F A -1.7209
364 D A -1.7468
365 A A -0.8868
366 T A -0.5160
367 Q A 0.0000
368 A A 0.0000
369 F A 0.0000
370 V A 0.1587
371 G A 0.0000
372 E A -0.5288
373 L A 0.0000
374 S A 0.0000
375 Q A -0.3806
376 F A 0.0000
377 N A 0.0000
378 I A 0.0000
379 W A 0.0000
380 D A -1.4902
381 R A -1.3133
382 V A -0.5414
383 L A 0.0000
384 R A -2.1808
385 A A -1.8902
386 Q A -1.9139
387 E A -1.3294
388 I A 0.0000
389 V A -1.3809
390 N A -1.0845
391 I A -0.8641
392 A A 0.0000
393 N A -1.7501
394 C A -1.0104
395 S A -0.8060
396 T A -0.8400
397 N A -1.3523
398 M A -0.5589
399 P A -0.6266
400 G A 0.0000
401 N A -1.4996
402 I A -1.0077
403 I A 0.0000
404 P A -0.6604
405 W A 0.0000
406 V A -0.4230
407 D A -2.3045
408 N A -2.4647
409 N A 0.0000
410 V A 0.0000
411 D A -1.4544
412 V A -0.0103
413 F A 0.4833
414 G A -0.0457
415 G A -0.0930
416 A A 0.0000
417 S A -0.2362
418 K A -0.3380
419 W A 0.8127
420 P A 0.3151
421 V A -0.0356
422 E A -0.9683
423 T A -1.2440
424 C A -1.1694
425 E A -2.0632
426 E A -1.8458
427 R A 0.0000
428 L A 0.6393
429 L A 1.0486
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.1496 4.265 View CSV PDB
4.5 -0.2068 4.2117 View CSV PDB
5.0 -0.2756 4.1587 View CSV PDB
5.5 -0.3459 4.1072 View CSV PDB
6.0 -0.4072 4.0573 View CSV PDB
6.5 -0.4502 4.0089 View CSV PDB
7.0 -0.4721 3.9636 View CSV PDB
7.5 -0.4781 3.9272 View CSV PDB
8.0 -0.474 3.9637 View CSV PDB
8.5 -0.4616 4.0694 View CSV PDB
9.0 -0.4407 4.1758 View CSV PDB