Project name: 4a444fc6cb2431f

Status: done

Started: 2026-06-05 07:30:46
Chain sequence(s) 1: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRATLAEKLGGSAVISLEGKPL
input PDB
Selected Chain(s) 1
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with 1 chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/4a444fc6cb2431f/tmp/folded.pdb                (00:03:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:43)
Show buried residues

Minimal score value
-3.7346
Maximal score value
1.0403
Average score
-1.1719
Total score value
-194.5291

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M 1 0.9478
2 A 1 -0.0745
3 S 1 -0.5788
4 G 1 -1.0170
5 V 1 0.0000
6 A 1 -0.9319
7 V 1 -0.5862
8 S 1 -1.0095
9 D 1 -2.1770
10 G 1 -1.5984
11 V 1 0.0000
12 I 1 -1.5965
13 K 1 -2.7273
14 V 1 -1.8041
15 F 1 0.0000
16 N 1 -2.2163
17 D 1 -2.4366
18 M 1 0.0000
19 K 1 -2.2581
20 V 1 -1.5657
21 R 1 -2.6846
22 K 1 -2.7653
23 S 1 -1.5475
24 S 1 -1.5299
25 T 1 -1.6050
26 P 1 -2.3524
27 E 1 -3.3932
28 E 1 -3.2740
29 V 1 0.0000
30 K 1 -3.5210
31 K 1 -3.5310
32 R 1 -2.5146
33 K 1 -1.5551
34 K 1 0.0000
35 A 1 0.0000
36 V 1 0.0000
37 L 1 0.0000
38 F 1 0.0000
39 C 1 -0.3318
40 L 1 0.0000
41 S 1 -2.2279
42 E 1 -3.3445
43 D 1 -3.7346
44 K 1 -3.1980
45 K 1 -3.2665
46 N 1 -1.9850
47 I 1 0.0000
48 I 1 0.0263
49 L 1 -0.2204
50 E 1 -1.2142
51 E 1 -2.3098
52 G 1 -1.8286
53 K 1 -1.7163
54 E 1 -1.2481
55 I 1 0.0000
56 L 1 -0.9021
57 V 1 -1.2765
58 G 1 -2.0128
59 D 1 -1.5955
60 V 1 -1.1739
61 G 1 -1.6739
62 Q 1 -1.9068
63 T 1 -1.2064
64 V 1 -1.1515
65 D 1 -2.2255
66 D 1 -1.3536
67 P 1 0.0000
68 Y 1 0.0000
69 A 1 -1.1000
70 T 1 -0.9380
71 F 1 0.0000
72 V 1 0.0000
73 K 1 -1.9663
74 M 1 -1.2071
75 L 1 0.0000
76 P 1 -2.0239
77 D 1 -3.4576
78 K 1 -3.5618
79 D 1 -2.8060
80 C 1 0.0000
81 R 1 -0.6679
82 Y 1 0.0000
83 A 1 0.0000
84 L 1 0.0000
85 Y 1 0.0000
86 D 1 0.0000
87 A 1 0.0000
88 T 1 -1.6666
89 Y 1 0.0000
90 E 1 -2.4168
91 T 1 -2.1220
92 K 1 -2.8469
93 E 1 -3.2530
94 S 1 -2.9268
95 K 1 -3.4212
96 K 1 -3.1243
97 E 1 -2.9728
98 D 1 -1.7254
99 L 1 -0.9809
100 V 1 0.0000
101 F 1 0.0000
102 I 1 0.0000
103 F 1 0.0000
104 W 1 0.0000
105 A 1 0.0000
106 P 1 0.0000
107 E 1 -2.5349
108 S 1 -2.1023
109 A 1 0.0000
110 P 1 -0.6769
111 L 1 0.6386
112 K 1 -0.5744
113 S 1 -0.4389
114 K 1 -0.0896
115 M 1 1.0403
116 I 1 0.8589
117 Y 1 0.0000
118 A 1 0.3555
119 S 1 0.5051
120 S 1 0.0000
121 K 1 -0.7905
122 D 1 -1.7483
123 A 1 0.0000
124 I 1 0.0000
125 K 1 -2.0930
126 K 1 -2.7365
127 K 1 -1.9571
128 L 1 0.0000
129 T 1 -1.3365
130 G 1 -1.3789
131 I 1 -1.4754
132 K 1 -1.8713
133 H 1 -1.3347
134 E 1 -1.2225
135 L 1 0.0000
136 Q 1 -1.3585
137 A 1 0.0000
138 N 1 -1.8711
139 C 1 -1.9327
140 Y 1 -2.3198
141 E 1 -3.0808
142 E 1 -3.3055
143 V 1 0.0000
144 K 1 -2.9245
145 D 1 -2.3195
146 R 1 -1.2833
147 A 1 -1.1254
148 T 1 -1.7010
149 L 1 0.0000
150 A 1 0.0000
151 E 1 -2.3561
152 K 1 -2.1374
153 L 1 0.0000
154 G 1 -1.2802
155 G 1 -1.5246
156 S 1 -0.8101
157 A 1 -0.9313
158 V 1 0.0000
159 I 1 -0.0175
160 S 1 0.0000
161 L 1 0.0000
162 E 1 -0.9389
163 G 1 -0.8168
164 K 1 -0.4088
165 P 1 0.2067
166 L 1 0.8382
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.1899 2.382 View CSV PDB
4.5 -1.2857 2.3766 View CSV PDB
5.0 -1.4024 2.3717 View CSV PDB
5.5 -1.5147 2.3741 View CSV PDB
6.0 -1.5931 2.3877 View CSV PDB
6.5 -1.6148 2.4112 View CSV PDB
7.0 -1.5782 2.4429 View CSV PDB
7.5 -1.5011 2.4807 View CSV PDB
8.0 -1.4023 2.522 View CSV PDB
8.5 -1.2893 2.5641 View CSV PDB
9.0 -1.1622 2.6049 View CSV PDB