Project name: 4aeb6ee6204d5b2

Status: done

Started: 2026-02-17 14:53:44
Chain sequence(s) A: VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEGRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:04)
Show buried residues

Minimal score value
-3.5984
Maximal score value
0.6495
Average score
-1.0935
Total score value
-203.3991

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 V A 0.4357
2 G A 0.3483
3 S A -0.0092
4 L A 0.0803
5 N A 0.0000
6 C A 0.0000
7 I A 0.0000
8 V A 0.0000
9 A A 0.1812
10 V A 0.0000
11 S A 0.0000
12 Q A -2.0761
13 N A -1.5989
14 M A -0.6108
15 G A 0.0000
16 I A 0.0657
17 G A 0.0000
18 K A -2.1326
19 N A -2.2979
20 G A -1.7816
21 D A -1.8868
22 L A 0.2774
23 P A -0.9551
24 W A 0.0000
25 P A -0.5807
26 P A -1.0795
27 L A 0.0000
28 R A -3.1114
29 N A -3.0059
30 E A -2.3422
31 G A -2.3920
32 R A -3.3525
33 Y A 0.0000
34 F A -1.4099
35 Q A -2.2940
36 R A -2.3467
37 M A -1.0989
38 T A 0.0000
39 T A -1.1630
40 T A -0.7356
41 S A -0.8408
42 S A -0.4468
43 V A -0.5843
44 E A -2.0392
45 G A -1.9660
46 K A -1.9042
47 Q A -1.6582
48 N A 0.0000
49 L A 0.0000
50 V A 0.0000
51 I A 0.0000
52 M A 0.0000
53 G A -0.9781
54 K A -1.3671
55 K A -1.6200
56 T A -0.7119
57 W A 0.0000
58 F A 0.3995
59 S A -0.5298
60 I A -0.8832
61 P A -1.7169
62 E A -2.9213
63 K A -3.0482
64 N A -2.5908
65 R A -2.1990
66 P A -1.8791
67 L A 0.0000
68 K A -2.1205
69 G A -1.3881
70 R A 0.0000
71 I A -0.5215
72 N A 0.0000
73 L A 0.0000
74 V A 0.0000
75 L A -1.3453
76 S A 0.0000
77 R A -3.5984
78 E A -3.5003
79 L A -2.7316
80 K A -3.3264
81 E A -2.8704
82 P A -1.5490
83 P A -1.1891
84 Q A -1.9053
85 G A -1.3254
86 A A -0.8788
87 H A -0.7296
88 F A 0.0762
89 L A -1.0664
90 S A 0.0000
91 R A -3.3527
92 S A -2.3191
93 L A 0.0000
94 D A -2.7769
95 D A -2.4921
96 A A 0.0000
97 L A -1.4515
98 K A -2.5321
99 L A -1.8420
100 T A 0.0000
101 E A -2.5762
102 Q A -2.3652
103 P A -2.1028
104 E A -2.5446
105 L A 0.0000
106 A A -2.0505
107 N A -2.4996
108 K A -2.4328
109 V A 0.0000
110 D A 0.0000
111 M A 0.0801
112 V A 0.0000
113 W A 0.0000
114 I A 0.0000
115 V A 0.1954
116 G A 0.0000
117 G A -0.6115
118 S A -0.4467
119 S A -0.9166
120 V A 0.0000
121 Y A 0.0000
122 K A -2.8172
123 E A -2.5402
124 A A 0.0000
125 M A 0.0000
126 N A -2.3985
127 H A -2.0353
128 P A -1.7823
129 G A -1.8460
130 H A -1.9425
131 L A 0.0000
132 K A -0.7267
133 L A 0.0000
134 F A 0.0000
135 V A 0.0000
136 T A 0.0000
137 R A -0.7789
138 I A 0.0000
139 M A -1.3422
140 Q A -1.9254
141 D A -2.8006
142 F A -1.9434
143 E A -2.6237
144 S A -2.0323
145 D A -2.3686
146 T A -0.5418
147 F A 0.5902
148 F A 0.0000
149 P A -1.1760
150 E A -1.7255
151 I A -1.3429
152 D A -1.4071
153 L A -0.4892
154 E A -2.1001
155 K A -2.6565
156 Y A 0.0000
157 K A -1.6296
158 L A 0.3352
159 L A -0.3372
160 P A -0.8739
161 E A -1.4160
162 Y A -0.5202
163 P A -0.4772
164 G A -0.5150
165 V A 0.0000
166 L A 0.6495
167 S A -0.6717
168 D A -0.9897
169 V A -0.3792
170 Q A -1.4299
171 E A -2.8483
172 E A -2.7666
173 K A -2.4661
174 G A -1.9722
175 I A 0.0000
176 K A -2.2609
177 Y A 0.0000
178 K A -0.9059
179 F A -0.2421
180 E A -0.2486
181 V A 0.0000
182 Y A 0.0000
183 E A -1.2237
184 K A 0.0000
185 N A -3.0388
186 D A -3.0529
Download PDB file
View in 3Dmol