Project name: new 9

Status: done

Started: 2026-03-17 06:31:33
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/4b9dc11a293cae1/tmp/folded.pdb                (00:02:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:56)
Show buried residues

Minimal score value
-2.7469
Maximal score value
1.5374
Average score
-0.7055
Total score value
-174.259

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7422
2 I A 0.0000
3 V A 0.7009
4 L A 0.0000
5 T A -0.6369
6 Q A -0.6750
7 S A -0.7250
8 P A -0.3041
9 A A -0.2919
10 T A -0.3283
11 L A -0.2801
12 S A -0.6277
13 L A -1.1345
14 S A -1.7201
15 P A -1.9677
16 G A -1.7882
17 E A -2.3954
18 R A -2.6860
19 A A 0.0000
20 T A -0.6810
21 L A 0.0000
22 S A -0.9491
23 C A 0.0000
24 R A -2.4759
25 V A 0.0000
26 S A -1.2515
27 Q A -2.5091
28 N A -2.7469
29 V A 0.0000
30 S A -1.4861
31 S A -1.0736
32 N A -1.4206
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.1634
40 P A -0.7801
41 G A -1.1861
42 Q A -1.5499
43 A A -1.1832
44 P A 0.0000
45 R A -1.4738
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -0.9725
51 T A 0.0000
52 S A -1.0396
53 N A -1.3718
54 R A -1.5414
55 A A 0.0000
56 T A -0.8187
57 G A -0.7419
58 I A -0.6319
59 P A -0.3878
60 A A -0.3376
61 R A -0.7401
62 F A 0.0000
63 S A -0.6083
64 G A -0.6899
65 S A -0.7794
66 G A -1.0900
67 S A -1.3127
68 G A -1.6809
69 T A -2.0977
70 D A -2.3518
71 F A 0.0000
72 T A -0.8115
73 L A 0.0000
74 T A -0.5941
75 I A 0.0000
76 S A -1.3380
77 S A -1.6810
78 L A 0.0000
79 E A -2.0086
80 P A -1.9975
81 E A -2.3423
82 D A 0.0000
83 F A -0.4323
84 A A 0.0000
85 V A -0.0154
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A 0.0000
92 R A -2.5585
93 N A -1.9515
94 W A -0.6613
95 P A -0.8739
96 L A 0.0000
97 T A -0.3016
98 F A 0.1708
99 G A 0.0000
100 G A -0.7633
101 G A -0.6729
102 T A 0.0000
103 K A -0.6099
104 V A 0.0000
105 E A -0.7960
106 I A -1.5841
107 K A -2.1821
108 G A -1.7301
109 G A -1.5881
110 G A -1.4250
111 G A -1.1299
112 S A -1.3729
113 G A -1.4533
114 G A -1.6763
115 G A -1.6475
116 G A -1.6421
117 S A -1.1308
118 G A -1.3421
119 G A -1.4698
120 G A -1.5407
121 G A -1.5359
122 S A -1.7383
123 E A -2.4521
124 V A -1.5319
125 Q A -1.4690
126 L A 0.0000
127 V A 0.7983
128 E A 0.0000
129 S A -0.2021
130 G A -0.7040
131 G A 0.1268
132 G A 0.6274
133 L A 1.3201
134 V A 0.0000
135 Q A -1.4062
136 P A -1.6286
137 G A -1.4076
138 G A -0.9767
139 S A -1.2582
140 L A -0.9075
141 R A -1.8197
142 L A 0.0000
143 S A -0.3653
144 C A 0.0000
145 A A -0.1901
146 A A 0.0000
147 S A -1.0203
148 G A -1.1458
149 F A -0.9257
150 T A -0.6730
151 F A 0.0000
152 S A -1.5412
153 R A -2.0992
154 Y A -1.1319
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6533
162 A A -1.0490
163 P A -0.8406
164 G A -1.4460
165 K A -2.2706
166 G A -1.3651
167 L A 0.0000
168 E A -0.9731
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 S A 0.0000
173 I A 0.0000
174 S A -0.2031
175 A A -0.8632
176 S A -0.7801
177 G A -0.4262
178 A A -0.1368
179 T A -0.0345
180 T A 0.1496
181 Y A 0.1181
182 Y A -0.6659
183 A A 0.0000
184 D A -2.6306
185 P A -1.8509
186 V A 0.0000
187 K A -2.6169
188 G A -1.8030
189 R A -1.6293
190 F A 0.0000
191 T A -0.8257
192 I A 0.0000
193 S A -0.4112
194 R A -0.9403
195 D A -1.4688
196 N A -1.8426
197 S A -1.5590
198 K A -2.3774
199 N A -1.7658
200 T A -1.0032
201 L A 0.0000
202 Y A -0.5052
203 L A 0.0000
204 Q A -1.2494
205 M A 0.0000
206 N A -1.4436
207 S A -1.2685
208 L A 0.0000
209 R A -2.4272
210 A A -1.7993
211 E A -2.2921
212 D A 0.0000
213 T A -0.4506
214 A A 0.0000
215 V A 0.6732
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A -0.7134
222 Q A 0.0000
223 D A -1.9368
224 F A -0.5804
225 D A -0.9192
226 I A 1.1610
227 L A 0.5309
228 T A 0.4482
229 G A 0.3296
230 Y A 1.1006
231 L A 0.0000
232 N A -0.1723
233 W A 0.0000
234 F A 0.0000
235 D A -1.0364
236 P A -1.1485
237 W A 0.0000
238 G A 0.0000
239 Q A -1.1858
240 G A 0.0000
241 T A 0.5135
242 L A 1.5374
243 V A 0.0000
244 T A 0.2288
245 V A 0.0000
246 S A -0.7949
247 S A -0.5563
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5568 3.3955 View CSV PDB
4.5 -0.5938 3.1826 View CSV PDB
5.0 -0.6388 2.9386 View CSV PDB
5.5 -0.6846 2.682 View CSV PDB
6.0 -0.7238 2.4213 View CSV PDB
6.5 -0.7503 2.2068 View CSV PDB
7.0 -0.7626 2.2068 View CSV PDB
7.5 -0.7644 2.2068 View CSV PDB
8.0 -0.7598 2.2068 View CSV PDB
8.5 -0.7498 2.2068 View CSV PDB
9.0 -0.7343 2.2068 View CSV PDB