Project name: 4c1947cd8e96bd7

Status: done

Started: 2026-05-30 05:12:27
Chain sequence(s) A: MKAIQYTRIGAEPELTEIPKPEPGPGEVLLEVTAAGVCHSDDFIMSLPEEQYTYGLPLTLGHEGAGKVAAVGEGVEGLDIGTNVVVYGPWGCGNCWHCSQGLENYCSRAQELGINPPGLGAPGALAEFMIVDSPRHLVPIGDLDPVKTVPLTDAGLTPYHAIKRSLPKLRGGSYAVVIGTGGLGHVAIQLLRHLSAATVIALDVSADKLELATKVGAHEVVLSDKDAAENVRKITGSQGAALVLDFVGYQPTIDTAMAVAGVGSDVTIVGIGDGQAHAKVGFFQSPYEASVTVPYWGARNELIELIDLAHAGIFDIAVETFSLDNGAEAYRRLAAGTLSGRAVVVPGL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage Used: no changes made
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:08)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:05)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:59:42)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:59:43)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:59:45)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:59:46)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:59:48)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:59:49)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:59:50)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:59:52)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:59:53)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:59:54)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:59:56)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:59:57)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:59:58)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (01:00:03)
[INFO]       Main:     Simulation completed successfully.                                          (01:00:05)
Show buried residues

Minimal score value
-3.2771
Maximal score value
2.1718
Average score
-0.5367
Total score value
-186.7618

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.3765
2 K A -1.3453
3 A A 0.0000
4 I A 0.0000
5 Q A -0.4700
6 Y A 0.0000
7 T A -0.6566
8 R A -0.6343
9 I A 1.0551
10 G A -0.1613
11 A A -0.7694
12 E A -1.6714
13 P A -1.5016
14 E A -0.8018
15 L A -0.2168
16 T A -0.4014
17 E A -1.2690
18 I A 0.5531
19 P A -0.3956
20 K A -1.5244
21 P A -1.2526
22 E A -2.4216
23 P A -1.5992
24 G A -1.1617
25 P A -0.9885
26 G A -1.3494
27 E A -1.5440
28 V A 0.0000
29 L A -0.3290
30 L A 0.0000
31 E A -1.5235
32 V A 0.0000
33 T A -0.6402
34 A A 0.0000
35 A A 0.0000
36 G A 0.0000
37 V A 0.0000
38 C A 0.0189
39 H A -0.0361
40 S A 0.1075
41 D A 0.0000
42 D A -0.1628
43 F A 0.0935
44 I A 0.0000
45 M A 0.0000
46 S A -0.0838
47 L A -0.3156
48 P A -0.9514
49 E A -1.6757
50 E A -2.2387
51 Q A -1.4593
52 Y A 0.0000
53 T A -0.9820
54 Y A -0.2941
55 G A -0.0848
56 L A 0.2200
57 P A -0.0447
58 L A 0.0000
59 T A 0.0000
60 L A 0.0000
61 G A 0.0000
62 H A 0.0000
63 E A 0.0000
64 G A 0.0000
65 A A 0.0000
66 G A 0.0000
67 K A -1.7526
68 V A -0.4050
69 A A -0.0971
70 A A 0.1068
71 V A -0.2989
72 G A -1.4202
73 E A -2.5583
74 G A -2.0817
75 V A -2.2000
76 E A -3.0765
77 G A -1.6395
78 L A -1.6332
79 D A -1.5137
80 I A 0.2674
81 G A -0.2732
82 T A -0.6579
83 N A -1.3094
84 V A 0.0000
85 V A 0.0000
86 V A 0.0000
87 Y A 0.0000
88 G A 0.0000
89 P A 0.0000
90 W A 0.0000
91 G A -0.7417
92 C A -0.6943
93 G A -1.2645
94 N A -1.2362
95 C A 0.0000
96 W A 0.1635
97 H A -0.0218
98 C A 0.0000
99 S A -0.8705
100 Q A -0.6513
101 G A -0.4618
102 L A 0.2486
103 E A 0.0566
104 N A 0.0000
105 Y A 0.0000
106 C A 0.0000
107 S A -1.2537
108 R A -2.3872
109 A A -1.7948
110 Q A -2.3479
111 E A -2.4016
112 L A -1.5553
113 G A -1.0734
114 I A -0.1246
115 N A -0.0985
116 P A 0.0000
117 P A 0.0000
118 G A 0.0000
119 L A 0.0000
120 G A 0.0000
121 A A 0.0000
122 P A -0.6579
123 G A 0.0000
124 A A 0.0000
125 L A 0.0000
126 A A 0.0000
127 E A -0.7037
128 F A -0.7468
129 M A 0.0000
130 I A 0.0000
131 V A 0.0000
132 D A -1.3563
133 S A -1.4026
134 P A 0.0000
135 R A -2.8741
136 H A 0.0000
137 L A 0.0000
138 V A 0.0000
139 P A 0.0000
140 I A 0.0000
141 G A -1.7557
142 D A -2.5688
143 L A 0.0000
144 D A -2.2167
145 P A -1.0719
146 V A -0.2022
147 K A -1.4802
148 T A 0.0000
149 V A 0.0000
150 P A 0.0000
151 L A 0.0000
152 T A 0.0000
153 D A 0.0000
154 A A 0.0000
155 G A 0.0000
156 L A 0.0000
157 T A 0.0000
158 P A 0.0000
159 Y A 0.0000
160 H A 0.0000
161 A A 0.0000
162 I A 0.0000
163 K A -0.2485
164 R A -0.3903
165 S A 0.2200
166 L A 1.2907
167 P A 0.0000
168 K A 0.1051
169 L A 0.5277
170 R A -1.5334
171 G A -1.2587
172 G A -0.9534
173 S A 0.0000
174 Y A 0.0000
175 A A 0.0000
176 V A 0.0000
177 V A 0.0000
178 I A 0.0000
179 G A 0.0000
180 T A 0.0000
181 G A 0.0000
182 G A 0.0000
183 L A 0.0000
184 G A 0.0000
185 H A 0.0000
186 V A 0.0000
187 A A 0.0000
188 I A 0.0000
189 Q A -1.0075
190 L A 0.0000
191 L A 0.0000
192 R A -1.6095
193 H A -1.3101
194 L A -0.0691
195 S A -0.7010
196 A A 0.0000
197 A A -0.6060
198 T A -0.6891
199 V A 0.0000
200 I A 0.0000
201 A A 0.0000
202 L A 0.0000
203 D A -0.1298
204 V A -0.0078
205 S A -0.2946
206 A A -0.5616
207 D A -1.4106
208 K A -0.9497
209 L A -0.9334
210 E A -2.3125
211 L A -1.4941
212 A A 0.0000
213 T A -1.8816
214 K A -2.1258
215 V A -1.3794
216 G A -1.2075
217 A A -1.4367
218 H A -1.4526
219 E A -1.0191
220 V A -0.2490
221 V A 0.0751
222 L A -0.4877
223 S A -1.6230
224 D A -3.0899
225 K A -3.2771
226 D A -2.9267
227 A A 0.0000
228 A A -1.8126
229 E A -2.9705
230 N A 0.0000
231 V A 0.0000
232 R A -3.1689
233 K A -2.9084
234 I A -1.5646
235 T A 0.0000
236 G A -1.8597
237 S A -1.1935
238 Q A -1.1021
239 G A -1.1394
240 A A 0.0000
241 A A 0.0000
242 L A 0.0000
243 V A 0.0000
244 L A 0.0000
245 D A 0.0000
246 F A 0.0000
247 V A 0.1626
248 G A -0.4540
249 Y A -0.8074
250 Q A -1.4299
251 P A -1.0001
252 T A -0.5688
253 I A 0.0000
254 D A -0.9523
255 T A -0.7373
256 A A 0.0000
257 M A 0.7257
258 A A -0.1493
259 V A 0.0000
260 A A 0.2012
261 G A 0.0000
262 V A 0.1737
263 G A -0.3147
264 S A 0.0000
265 D A 0.0000
266 V A 0.0000
267 T A 0.0000
268 I A 0.0000
269 V A 0.0000
270 G A 0.0000
271 I A 0.0000
272 G A 0.0000
273 D A -1.9503
274 G A -1.7450
275 Q A 0.0000
276 A A -1.3510
277 H A -1.0229
278 A A 0.0000
279 K A -1.4012
280 V A -0.0449
281 G A 0.5564
282 F A 2.1718
283 F A 1.8561
284 Q A 0.0732
285 S A -0.1344
286 P A -0.1787
287 Y A 0.5293
288 E A 0.0645
289 A A 0.0000
290 S A 0.1466
291 V A 0.0680
292 T A 0.0000
293 V A 0.0886
294 P A 0.0000
295 Y A 0.0000
296 W A 0.0000
297 G A 0.0000
298 A A 0.0000
299 R A -2.1302
300 N A -2.4958
301 E A -1.7819
302 L A 0.0000
303 I A -1.5831
304 E A -2.1216
305 L A 0.0000
306 I A 0.0000
307 D A -2.4090
308 L A -1.5086
309 A A 0.0000
310 H A -2.5238
311 A A -1.0710
312 G A -1.3281
313 I A 0.0000
314 F A 0.0000
315 D A -1.9241
316 I A 0.0000
317 A A -0.3672
318 V A 0.1677
319 E A -0.2049
320 T A 0.1014
321 F A 0.0000
322 S A -0.5753
323 L A -0.9818
324 D A -1.7377
325 N A -1.5564
326 G A 0.0000
327 A A -1.4278
328 E A -1.9444
329 A A 0.0000
330 Y A -1.3868
331 R A -2.3985
332 R A -1.6726
333 L A 0.0000
334 A A -0.8403
335 A A -0.6354
336 G A -0.6570
337 T A 0.0000
338 L A 0.0689
339 S A 0.0000
340 G A 0.0000
341 R A 0.0000
342 A A 0.0000
343 V A 0.0000
344 V A 0.0000
345 V A 0.0000
346 P A -0.2393
347 G A 0.1747
348 L A 1.1568
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5367 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_3 -0.5367 View CSV PDB
input -0.5565 View CSV PDB
model_11 -0.5585 View CSV PDB
model_0 -0.5696 View CSV PDB
model_10 -0.5751 View CSV PDB
model_6 -0.5855 View CSV PDB
CABS_average -0.5918 View CSV PDB
model_1 -0.5938 View CSV PDB
model_2 -0.5939 View CSV PDB
model_8 -0.6005 View CSV PDB
model_9 -0.6054 View CSV PDB
model_4 -0.6079 View CSV PDB
model_7 -0.626 View CSV PDB
model_5 -0.6485 View CSV PDB