Project name: 4d057cffe87e990

Status: done

Started: 2026-07-12 04:03:08
Chain sequence(s) A: QVQLVQSGAEVKKPGASVKVSCKASGSSFTGYNMNWVRQAPGQGLEWMGAIDPYYGGTSYNQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCARGMEYWGQGTTVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLSVTPGQPASISCKSSQSLVHRNGNTYLHWYLQKPGQPPQLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPPLTFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:14)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/4d057cffe87e990/tmp/folded.pdb                (00:02:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:20)
Show buried residues

Minimal score value
-3.2562
Maximal score value
1.54
Average score
-0.6499
Total score value
-156.6335

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4752
2 V A -1.0165
3 Q A -1.2215
4 L A 0.0000
5 V A -0.1696
6 Q A 0.0000
7 S A -0.7015
8 G A -0.7204
9 A A -0.1566
10 E A -0.3210
11 V A 0.7782
12 K A -0.9066
13 K A -2.2775
14 P A -2.3109
15 G A -1.8581
16 A A -1.5548
17 S A -1.6243
18 V A 0.0000
19 K A -1.8709
20 V A 0.0000
21 S A -0.7049
22 C A 0.0000
23 K A -0.7977
24 A A 0.0000
25 S A -0.7861
26 G A -1.1768
27 S A -0.8192
28 S A -0.4244
29 F A 0.0000
30 T A 0.2734
31 G A -0.2016
32 Y A 0.1136
33 N A -0.5165
34 M A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6042
40 A A -1.0130
41 P A -1.0434
42 G A -1.2178
43 Q A -1.7421
44 G A -1.0629
45 L A 0.0000
46 E A -0.5902
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 A A 0.0000
51 I A 0.0000
52 D A -0.3071
53 P A 0.0000
54 Y A 1.4797
55 Y A 1.5400
56 G A 0.1398
57 G A -0.1868
58 T A -0.3430
59 S A -0.3497
60 Y A -0.7229
61 N A -1.3362
62 Q A -2.5853
63 K A -2.8234
64 F A 0.0000
65 Q A -2.2454
66 G A -1.3426
67 W A -1.1841
68 V A 0.0000
69 T A -0.7603
70 M A 0.0000
71 T A -0.7300
72 R A -0.8066
73 D A -0.8103
74 T A -0.0075
75 S A 0.1696
76 I A 0.8681
77 S A -0.0912
78 T A 0.0000
79 A A 0.0000
80 Y A -0.8312
81 M A 0.0000
82 E A -1.5152
83 L A 0.0000
84 S A -1.6248
85 R A -2.4261
86 L A 0.0000
87 R A -2.7672
88 S A -2.1536
89 D A -2.5220
90 D A 0.0000
91 T A -0.8134
92 A A 0.0000
93 V A 0.1574
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A -0.1936
100 M A 0.0000
101 E A -0.2729
102 Y A -0.2176
103 W A -0.2988
104 G A 0.0000
105 Q A -1.3129
106 G A -0.6436
107 T A 0.0000
108 T A -0.0334
109 V A 0.0000
110 T A -0.3282
111 V A 0.0000
112 S A -1.2604
113 S A -1.6220
114 G A -1.2954
115 G A -1.1039
116 G A -1.1283
117 G A -1.1392
118 S A -0.9439
119 G A -1.2964
120 G A -1.3601
121 G A -1.4278
122 G A -1.1499
123 S A -1.0004
124 G A -1.3526
125 G A -1.7625
126 G A -1.2211
127 G A -1.5266
128 S A -0.8032
129 D A -0.6174
130 I A 0.0000
131 V A 1.1022
132 M A 0.0000
133 T A -0.1144
134 Q A 0.0000
135 T A 0.1294
136 P A 0.4790
137 L A 1.1961
138 S A 0.1331
139 L A -0.1649
140 S A -0.9410
141 V A 0.0000
142 T A -1.4423
143 P A -1.6983
144 G A -1.8441
145 Q A -2.0770
146 P A -2.0920
147 A A 0.0000
148 S A -0.8869
149 I A 0.0000
150 S A -0.7651
151 C A 0.0000
152 K A -1.6559
153 S A 0.0000
154 S A -0.7237
155 Q A -1.3735
156 S A -0.8672
157 L A 0.0000
158 V A 0.0535
159 H A -1.3299
160 R A -2.5310
161 N A -2.4108
162 G A -1.5904
163 N A -1.2489
164 T A -0.5986
165 Y A -0.2043
166 L A 0.0000
167 H A -0.6600
168 W A 0.0000
169 Y A 0.0000
170 L A 0.0000
171 Q A 0.0000
172 K A -1.2040
173 P A -0.8012
174 G A -1.2182
175 Q A -1.5459
176 P A -1.0155
177 P A 0.0000
178 Q A -0.7036
179 L A 0.0000
180 L A 0.0000
181 I A 0.0000
182 H A -1.2855
183 K A -1.4169
184 V A 0.0000
185 S A -1.3019
186 N A -1.8271
187 R A -2.1179
188 F A -0.8992
189 S A -0.6291
190 G A -0.8143
191 V A -0.8519
192 P A -1.2253
193 D A -2.3915
194 R A -2.1404
195 F A 0.0000
196 S A -1.6218
197 G A 0.0000
198 S A -1.1096
199 G A -1.0651
200 S A -0.7211
201 G A -0.7288
202 T A -1.3884
203 D A -2.1218
204 F A 0.0000
205 T A -1.1297
206 L A 0.0000
207 K A -2.2101
208 I A 0.0000
209 S A -2.3811
210 R A -3.2562
211 V A 0.0000
212 E A -2.4455
213 A A -1.4171
214 E A -2.0756
215 D A 0.0000
216 V A -0.7850
217 G A 0.0000
218 V A -0.0731
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 S A 0.0000
223 Q A 0.0000
224 S A 0.2095
225 T A 0.0000
226 H A 0.1385
227 V A 1.2638
228 P A 0.4006
229 P A 0.0000
230 L A 0.0000
231 T A 0.3608
232 F A 0.2482
233 G A 0.0000
234 G A -0.3203
235 G A -0.1971
236 T A 0.0000
237 K A -0.5365
238 V A 0.0000
239 E A -1.2991
240 I A -1.1303
241 K A -1.7609
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6443 2.0711 View CSV PDB
4.5 -0.6731 2.0523 View CSV PDB
5.0 -0.7053 2.0365 View CSV PDB
5.5 -0.7337 2.03 View CSV PDB
6.0 -0.7511 2.0366 View CSV PDB
6.5 -0.7533 2.0486 View CSV PDB
7.0 -0.7413 2.0522 View CSV PDB
7.5 -0.7198 2.0436 View CSV PDB
8.0 -0.6927 2.0289 View CSV PDB
8.5 -0.661 2.0155 View CSV PDB
9.0 -0.6242 2.0072 View CSV PDB