Project name: 4eaa529c90969ef

Status: done

Started: 2026-06-16 05:21:55
Chain sequence(s) A: GRGGSSTDDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYYARQRVNIYHSPSLGIAVAIEGTNLFSSLNSSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations No
alphaCutter usage Used: no changes made
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:08)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:54)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:41:09)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:41:10)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:41:12)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:41:13)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:41:14)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:41:15)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:41:16)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:41:17)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:41:18)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:41:19)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:41:20)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:41:21)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:41:22)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:41:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:41:28)
Show buried residues

Minimal score value
-2.434
Maximal score value
1.9361
Average score
-0.2571
Total score value
-71.7248

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
26 G A -0.8215
27 R A -2.0225
28 G A -0.9054
29 G A -0.5954
30 S A -0.3284
31 S A -0.1901
32 T A -0.3972
33 D A -2.0258
34 Q A -1.5937
35 P A -0.2948
36 V A 0.9771
37 A A 0.1408
38 N A -0.6472
39 P A -0.4019
40 Y A 0.0000
41 N A -0.7746
42 T A -0.4777
43 K A -1.7657
44 E A -0.6551
45 I A 0.0000
46 S A 0.0000
47 L A 0.0000
48 A A 0.0000
49 A A 0.0000
50 G A 0.0000
51 L A 0.0000
52 V A 0.0000
53 Q A 0.0000
54 Q A 0.0000
55 T A 0.0000
56 Y A 0.5757
57 C A 0.3773
58 D A 0.0000
59 S A -0.0534
60 T A -0.1695
61 E A -0.6373
62 N A -0.9397
63 G A -0.6123
64 L A 0.0000
65 K A -1.7000
66 I A 0.0000
67 G A -0.5722
68 D A -1.2815
69 S A 0.0000
70 E A -1.2633
71 L A 0.0353
72 L A 0.7780
73 Y A 1.4072
74 T A 0.2828
75 M A 0.2499
76 G A 0.0000
77 E A -1.8646
78 G A -0.3326
79 Y A 1.2302
80 A A 0.1924
81 R A -0.3141
82 Q A 0.0000
83 R A -0.2144
84 V A 0.0000
85 N A 0.0000
86 I A 0.0000
87 Y A 0.0000
88 H A -0.1332
89 S A 0.0000
90 P A -0.2949
91 S A -0.2608
92 L A 0.0000
93 G A -0.0491
94 I A 0.0000
95 A A 0.0000
96 V A 0.0000
97 A A 0.0000
98 I A 0.0000
99 E A 0.0000
100 G A -0.0489
101 T A -0.1857
102 N A -0.6961
103 L A 0.6708
104 F A 0.0000
105 S A -0.1296
106 L A -0.0061
107 N A -1.2901
108 S A -0.7498
109 D A -1.9386
110 L A 0.0000
111 H A -1.0428
112 D A -0.5130
113 A A -0.0975
114 K A -0.5676
115 F A 0.0000
116 W A 0.6193
117 Q A -0.8075
118 E A -1.6230
119 D A -0.6550
120 P A -0.4091
121 N A -0.6222
122 E A -0.8384
123 R A -0.7303
124 Y A 0.0000
125 I A 1.8711
126 Q A -0.3759
127 Y A 0.0000
128 Y A 0.7810
129 P A -0.2977
130 K A -1.7955
131 G A -0.6865
132 T A -0.2106
133 K A -0.7252
134 L A 0.0000
135 M A 0.0000
136 H A -0.2085
137 G A -0.2103
138 F A 0.0000
139 Q A 0.0000
140 Q A -0.8938
141 A A 0.0000
142 Y A 0.0000
143 N A -0.4378
144 D A -0.7350
145 L A 0.0000
146 M A 0.0000
147 D A -1.2829
148 D A -0.5153
149 I A 0.0000
150 F A 0.0000
151 T A -0.1367
152 A A -0.0029
153 V A 0.0000
154 K A -1.0460
155 K A -1.7968
156 Y A -0.3500
157 K A -0.4557
158 K A -2.0780
159 E A -2.2086
160 K A -1.2500
161 N A -1.7057
162 E A -2.4340
163 K A -2.3043
164 R A -1.7172
165 V A 0.0000
166 T A 0.0000
167 V A 0.0000
168 I A 0.0000
169 G A 0.0000
170 H A 0.0000
171 S A 0.0000
172 L A 0.0000
173 G A 0.0000
174 A A 0.0000
175 A A 0.0000
176 M A 0.0000
177 G A 0.0000
178 L A 0.0000
179 L A 0.0000
180 C A 0.0000
181 A A 0.0000
182 M A 0.0000
183 D A 0.0000
184 I A 0.0000
185 E A -0.2423
186 L A 0.0000
187 R A -0.4510
188 M A 0.7321
189 D A -0.8730
190 G A 0.0000
191 G A -0.2402
192 L A 0.0000
193 Y A 0.4544
194 K A -0.2389
195 T A 0.0000
196 Y A 0.0000
197 L A 0.0000
198 F A 0.0000
199 G A 0.0000
200 L A 0.0000
201 P A 0.0000
202 R A 0.0000
203 L A 0.0000
204 G A 0.0000
205 N A -0.1402
206 P A -0.1068
207 T A -0.0325
208 F A 0.0000
209 A A 0.0000
210 S A -0.2404
211 F A 0.0000
212 V A 0.0000
213 D A -2.0272
214 Q A -1.6321
215 K A -0.7507
216 I A 0.0000
217 G A -0.6820
218 D A -1.9069
219 K A -0.9065
220 F A 0.0000
221 H A -0.1059
222 S A 0.0000
223 I A 0.0000
224 I A 0.0000
225 N A 0.0000
226 G A 0.0000
227 R A -1.8700
228 D A 0.0000
229 W A 0.1244
230 V A 0.0000
231 P A 0.0000
232 T A 0.0000
233 V A 0.1957
234 P A 0.0154
235 P A 0.0000
236 R A -1.1915
237 A A -0.1320
238 L A 0.1803
239 G A -0.3200
240 Y A 0.0000
241 Q A -0.1996
242 H A 0.0000
243 P A 0.0000
244 S A 0.0000
245 D A -0.5343
246 Y A 0.0000
247 V A 0.0000
248 W A 0.1201
249 I A 0.0000
250 Y A 0.6588
251 P A -0.1676
252 G A -0.7411
253 N A -1.4010
254 S A -0.4798
255 T A -0.0711
256 S A -0.0758
257 A A 0.0000
258 K A -0.3310
259 L A 0.0831
260 Y A 0.0000
261 P A -0.0776
262 G A -0.2622
263 Q A -0.1735
264 E A 0.0000
265 N A -0.2975
266 V A 0.0000
267 H A -1.0481
268 G A -0.4935
269 I A 0.0000
270 L A 0.4922
271 T A 0.4014
272 V A 1.7788
273 A A 0.3571
274 R A -0.7685
275 E A -1.4724
276 F A 1.5070
277 N A 0.2740
278 F A 1.5144
279 D A -1.3703
280 D A 0.0000
281 H A 0.0000
282 Q A -0.6090
283 G A -0.0491
284 I A 0.8369
285 Y A 0.0000
286 F A 0.1265
287 H A -0.5971
288 T A 0.0000
289 Q A -1.0664
290 I A 0.0000
291 G A -0.2014
292 A A 0.3324
293 V A 1.9361
294 M A 1.0478
295 G A -0.6118
296 E A -1.6682
297 C A 0.0000
298 P A -0.2487
299 A A -0.2398
300 Q A -1.1497
301 V A -0.0217
302 G A -0.0053
303 A A -0.1732
304 H A -0.9841
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.2571 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_11 -0.2571 View CSV PDB
input -0.2627 View CSV PDB
model_1 -0.2794 View CSV PDB
model_8 -0.2796 View CSV PDB
model_6 -0.2832 View CSV PDB
model_4 -0.2912 View CSV PDB
CABS_average -0.3003 View CSV PDB
model_9 -0.3041 View CSV PDB
model_2 -0.3061 View CSV PDB
model_5 -0.3065 View CSV PDB
model_7 -0.3147 View CSV PDB
model_3 -0.3151 View CSV PDB
model_10 -0.3196 View CSV PDB
model_0 -0.3472 View CSV PDB