Project name: 50747f20e25356c

Status: done

Started: 2026-03-12 18:28:29
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTGGGGSEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:56)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/50747f20e25356c/tmp/folded.pdb                (00:02:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:37)
Show buried residues

Minimal score value
-3.9505
Maximal score value
4.4745
Average score
-0.6329
Total score value
-148.105

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1693
2 H A -1.3858
3 H A -2.1093
4 H A -2.5614
5 H A -2.6871
6 H A -2.6155
7 H A -2.3619
8 F A 0.0000
9 D A -2.5555
10 A A -1.9713
11 S A -2.0393
12 N A -2.4485
13 F A 0.0000
14 K A -2.2743
15 D A -1.3343
16 F A 0.0000
17 S A -0.7891
18 S A -1.1808
19 I A 0.0000
20 A A -0.4912
21 S A -0.6964
22 A A -0.8639
23 S A -0.4763
24 S A 0.0000
25 S A -0.0725
26 W A 0.0000
27 Q A -1.0596
28 N A 0.0000
29 Q A -1.8933
30 S A -1.5038
31 G A -1.3861
32 S A 0.0000
33 T A -0.8740
34 M A 0.0000
35 I A 0.0542
36 I A 0.0000
37 Q A -1.0098
38 V A 0.0000
39 D A -0.7992
40 S A 0.2220
41 F A 1.0748
42 G A -0.5871
43 N A -1.1575
44 V A 0.0000
45 S A -1.0467
46 G A -0.6130
47 Q A -0.6040
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -2.4830
52 A A -1.8865
53 Q A -1.9191
54 G A -1.3508
55 T A -1.0468
56 G A -1.3375
57 C A 0.0000
58 Q A -1.9946
59 N A -1.9491
60 S A -1.3912
61 P A -0.9393
62 Y A 0.0000
63 P A -0.8183
64 L A 0.0000
65 T A -0.8979
66 G A -1.2175
67 R A -1.9012
68 V A -0.8441
69 N A -0.9537
70 G A -0.8377
71 T A 0.0416
72 F A 1.3159
73 I A 0.0000
74 A A -0.3248
75 F A 0.0000
76 S A -0.5779
77 V A 0.0000
78 G A -1.0295
79 W A 0.0000
80 N A -2.7222
81 N A -1.8940
82 S A -1.2800
83 T A -1.5251
84 E A -2.5129
85 N A -2.8740
86 C A -1.9042
87 N A -2.2471
88 S A 0.0000
89 A A -0.4168
90 T A 0.0000
91 G A -0.5525
92 W A 0.0000
93 T A -0.0905
94 G A 0.7424
95 Y A 1.1086
96 A A 0.0000
97 Q A -0.6633
98 V A -1.0128
99 N A -1.1194
100 G A -1.3309
101 N A -2.1060
102 N A -1.5765
103 T A 0.0000
104 E A -0.6287
105 I A 0.0000
106 V A 0.3081
107 T A 0.0000
108 S A -0.9938
109 W A -1.0587
110 N A -1.1125
111 L A -0.3416
112 A A -0.0786
113 Y A -0.4909
114 E A -1.8238
115 G A -1.1546
116 G A -1.0650
117 S A -0.9125
118 G A -1.0518
119 P A -0.8083
120 A A -0.0685
121 I A 0.8816
122 E A -0.8020
123 Q A -1.8075
124 G A -1.7618
125 Q A -1.8053
126 D A -1.1815
127 T A -0.8101
128 F A 0.0000
129 Q A -0.9829
130 Y A -0.1618
131 V A 0.2767
132 P A -0.5032
133 T A -0.7806
134 T A -1.2732
135 E A -2.9277
136 N A -2.7704
137 K A -2.7351
138 S A -0.9738
139 L A 0.9801
140 L A 0.5385
141 K A -1.9525
142 D A -2.5360
143 T A -1.5606
144 G A -1.7025
145 G A -1.3641
146 G A -1.3529
147 G A -1.5256
148 S A -1.9166
149 E A -2.4646
150 P A -1.7594
151 R A -2.1046
152 I A -0.4000
153 Q A -1.7012
154 K A -1.9293
155 E A -1.5715
156 Y A 0.7917
157 Y A 1.2736
158 Y A 0.8604
159 N A -0.3510
160 L A 0.3593
161 H A -1.5881
162 E A -2.9353
163 N A -3.1102
164 N A -2.8457
165 S A -2.4684
166 Q A -2.2924
167 A A -1.8594
168 N A -2.6968
169 H A -2.6099
170 N A -2.6137
171 K A -2.3587
172 F A -0.1436
173 H A -1.3500
174 E A -1.8298
175 M A -0.2122
176 P A -1.0882
177 E A -1.9806
178 Y A -1.0356
179 D A -2.7063
180 D A -2.7039
181 Q A -1.9597
182 L A -0.0839
183 P A -0.3961
184 D A -0.9335
185 F A 0.6118
186 P A -0.9209
187 H A -1.8217
188 K A -2.4053
189 Q A -2.3280
190 L A -1.3062
191 E A -3.1769
192 E A -3.8439
193 E A -3.9505
194 Q A -3.2177
195 N A -2.2559
196 P A -0.8720
197 F A 0.6621
198 H A -0.9593
199 K A -1.1329
200 L A 0.9672
201 S A -0.1218
202 E A -1.0046
203 V A 1.3127
204 L A 1.2712
205 N A -0.7564
206 S A -0.1739
207 G A 0.0238
208 S A 0.6735
209 V A 2.5334
210 V A 3.2215
211 P A 2.9564
212 L A 3.7203
213 W A 3.3110
214 L A 3.4960
215 V A 3.3194
216 N A 1.8019
217 P A 2.4982
218 I A 3.7798
219 Y A 3.8028
220 Y A 3.7773
221 V A 4.4745
222 L A 3.6985
223 E A 1.4562
224 L A 1.9680
225 F A 2.4637
226 P A 0.5558
227 R A -0.5722
228 A A 0.9189
229 I A 1.6809
230 S A 1.1571
231 Y A 1.8905
232 Y A 2.5205
233 F A 2.4855
234 N A 0.5437
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.1346 6.3438 View CSV PDB
4.5 -0.2082 6.3438 View CSV PDB
5.0 -0.2957 6.3438 View CSV PDB
5.5 -0.3761 6.3438 View CSV PDB
6.0 -0.4294 6.3438 View CSV PDB
6.5 -0.4484 6.3438 View CSV PDB
7.0 -0.4433 6.3438 View CSV PDB
7.5 -0.4281 6.3438 View CSV PDB
8.0 -0.4088 6.3438 View CSV PDB
8.5 -0.3854 6.3438 View CSV PDB
9.0 -0.3567 6.3438 View CSV PDB