Project name: 50eed69cc588fdc

Status: done

Started: 2026-08-20 07:25:51
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYCARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:23)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/50eed69cc588fdc/tmp/folded.pdb                (00:01:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:25)
Show buried residues

Minimal score value
-2.5584
Maximal score value
1.962
Average score
-0.5551
Total score value
-136.5428

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6077
2 V A -1.2984
3 Q A -1.9537
4 L A 0.0000
5 Q A -1.8371
6 E A 0.0000
7 S A -0.7072
8 G A -0.4139
9 P A 0.0228
10 G A 0.3962
11 L A 0.9649
12 V A 0.0000
13 K A -1.8568
14 P A -1.3641
15 S A -1.4647
16 Q A -2.0442
17 T A -1.5905
18 L A 0.0000
19 S A -0.8456
20 L A 0.0000
21 T A -0.6443
22 C A 0.0000
23 T A -1.2393
24 V A 0.0000
25 S A -1.3186
26 G A -1.3399
27 G A -1.0320
28 S A -0.7058
29 I A 0.0000
30 S A -0.2409
31 S A -0.3204
32 G A -0.0711
33 D A -0.0279
34 Y A 0.5937
35 Y A 0.6964
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A -0.6364
42 P A -0.7562
43 P A -0.8922
44 G A -1.4500
45 K A -2.2539
46 G A -1.3119
47 L A 0.0000
48 E A -0.7744
49 W A 0.0000
50 I A 0.0000
51 G A 0.0000
52 Y A 0.2036
53 I A 0.0000
54 Y A 0.3809
55 Y A 0.3806
56 S A -0.0298
57 G A -0.2922
58 S A -0.2342
59 T A -0.1776
60 D A -0.5647
61 Y A -0.7196
62 N A -0.9812
63 P A -1.3195
64 S A -1.1666
65 L A 0.0000
66 K A -2.0975
67 S A -1.4308
68 R A -1.6002
69 V A 0.0000
70 T A -0.9709
71 M A 0.0000
72 S A -0.3537
73 V A -0.4109
74 D A -1.2806
75 T A -1.0641
76 S A -1.3616
77 K A -2.2108
78 N A -1.5495
79 Q A -1.3041
80 F A 0.0000
81 S A -0.4705
82 L A 0.0000
83 K A -1.2496
84 V A 0.0000
85 N A -1.7330
86 S A -1.5465
87 V A 0.0000
88 T A -0.6966
89 A A -0.3068
90 A A -0.0750
91 D A 0.0000
92 T A 0.3134
93 A A 0.0000
94 V A 0.4484
95 Y A 0.0000
96 Y A 0.0000
97 C A 0.0000
98 A A 0.0000
99 R A 0.0000
100 V A 0.6195
101 S A 0.7751
102 I A 1.5116
103 F A 1.9620
104 G A 0.7235
105 V A 0.5634
106 G A 0.6793
107 T A 0.0000
108 F A 0.0000
109 D A -0.5090
110 Y A -0.5339
111 W A -0.8436
112 G A 0.0000
113 Q A -1.7597
114 G A -0.8087
115 T A -0.1150
116 L A 0.9345
117 V A 0.0000
118 T A 0.3997
119 V A 0.0000
120 S A -0.3853
121 S A -0.6587
122 A A -0.6544
123 A A -0.3644
124 G A -0.8412
125 G A -1.0834
126 G A -1.1197
127 G A -1.1595
128 S A -1.0268
129 G A -1.1410
130 G A -1.2265
131 G A -1.1895
132 G A -1.2333
133 S A -1.0433
134 G A -1.2181
135 G A -1.3600
136 G A -1.2374
137 G A -1.2436
138 S A -0.9649
139 D A -1.0439
140 I A -0.1909
141 V A 0.9545
142 M A 0.0000
143 T A -0.5858
144 Q A -0.6615
145 S A -0.7500
146 P A -0.3818
147 A A -0.4277
148 T A -0.6155
149 L A -0.3297
150 S A -0.4511
151 L A -0.6962
152 S A -0.9831
153 P A -1.4739
154 G A -1.7745
155 E A -2.3502
156 R A -2.5584
157 A A 0.0000
158 T A -0.6582
159 L A 0.0000
160 S A -0.8820
161 C A 0.0000
162 R A -2.3275
163 A A 0.0000
164 S A -0.8931
165 Q A -1.5998
166 S A -1.2313
167 V A 0.0000
168 S A -0.5150
169 S A -0.3151
170 Y A 0.6319
171 L A 0.0000
172 A A 0.0000
173 W A 0.0000
174 Y A 0.0000
175 Q A 0.0000
176 Q A 0.0000
177 K A -1.6655
178 P A -1.0342
179 G A -1.3857
180 Q A -2.0283
181 A A -1.4018
182 P A 0.0000
183 R A -1.6574
184 L A 0.0000
185 L A 0.0000
186 I A 0.0000
187 Y A -0.5199
188 D A -0.7497
189 A A 0.0000
190 S A -1.1475
191 N A -1.6904
192 R A -1.6651
193 A A -1.0308
194 T A -0.6504
195 G A -0.6596
196 I A 0.0000
197 P A -0.4424
198 A A -0.3777
199 R A -0.7135
200 F A 0.0000
201 S A -0.7190
202 G A 0.0000
203 S A -0.8455
204 G A -1.1209
205 S A -0.9542
206 G A -1.0520
207 T A -1.7561
208 D A -2.1640
209 F A 0.0000
210 T A -0.7690
211 L A 0.0000
212 T A -0.5876
213 I A 0.0000
214 S A -1.3402
215 S A -1.7082
216 L A 0.0000
217 E A -2.0211
218 P A -1.4249
219 E A -2.2107
220 D A 0.0000
221 F A -0.7452
222 A A 0.0000
223 V A -0.5657
224 Y A 0.0000
225 Y A 0.0000
226 C A 0.0000
227 H A 0.0000
228 Q A 0.0000
229 Y A 0.0000
230 G A -0.1536
231 S A -0.2903
232 T A -0.4413
233 P A -0.4697
234 L A 0.0000
235 T A 0.1276
236 F A 0.2518
237 G A 0.0000
238 G A -0.8344
239 G A -0.8047
240 T A 0.0000
241 K A -1.3779
242 A A 0.0000
243 E A -0.6890
244 I A 0.7097
245 K A -0.9383
246 A A -0.3701
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4945 4.9416 View CSV PDB
4.5 -0.5172 4.9312 View CSV PDB
5.0 -0.5432 4.9076 View CSV PDB
5.5 -0.5672 4.8677 View CSV PDB
6.0 -0.5825 4.8163 View CSV PDB
6.5 -0.5844 4.7595 View CSV PDB
7.0 -0.5731 4.7008 View CSV PDB
7.5 -0.5533 4.6415 View CSV PDB
8.0 -0.5287 4.582 View CSV PDB
8.5 -0.5007 4.5229 View CSV PDB
9.0 -0.4694 4.4649 View CSV PDB