Project name: 5e7d014311d7d4 [mutate: QA1B]

Status: done

Started: 2026-07-10 21:36:57
Chain sequence(s) B: QVQLVESGGGLVQPGGSLRLSCAASGFPFSSYGMGWVRQAPGKGLEWVSGINWSGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCADGLLFSYDDWGQGTQVTVSS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues QA1B
Energy difference between WT (input) and mutated protein (by FoldX) 0.154065 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:29)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/51df3bb3caaac60/tmp/folded.pdb                (00:00:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-2.9582
Maximal score value
3.1723
Average score
-0.5364
Total score value
-62.757

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A B -0.1753 mutated: QA1B
2 V B -0.4615
3 Q B -0.9534
4 L B 0.0000
5 V B 0.5497
6 E B 0.0000
7 S B -0.6641
8 G B -1.0361
9 G B -0.8161
10 G B -0.0666
11 L B 0.8984
12 V B 0.0000
13 Q B -1.5494
14 P B -1.8833
15 G B -1.5827
16 G B -1.0540
17 S B -1.3205
18 L B -0.9190
19 R B -2.1221
20 L B 0.0000
21 S B -0.4538
22 C B 0.0000
23 A B -0.3143
24 A B 0.0000
25 S B -0.7565
26 G B -0.5601
27 F B -0.2543
28 P B -0.4058
29 F B 0.0000
30 S B -0.6955
31 S B 0.0027
32 Y B 0.8311
33 G B 1.0178
34 M B 0.0000
35 G B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B 0.0000
39 Q B -0.8336
40 A B -1.3584
41 P B -0.9943
42 G B -1.4618
43 K B -2.1893
44 G B -1.0732
45 L B 0.2358
46 E B -0.6183
47 W B 0.0855
48 V B 0.0000
49 S B 0.0000
50 G B 0.1311
51 I B 0.0000
52 N B 0.1600
53 W B 0.0051
54 S B -0.5464
55 G B -0.8532
56 G B -0.7406
57 S B -0.6281
58 T B -0.4502
59 G B -0.6250
60 Y B -0.9474
61 A B -1.4395
62 D B -2.5094
63 S B -1.7326
64 V B 0.0000
65 K B -2.6584
66 G B -1.7834
67 R B -1.5497
68 F B 0.0000
69 T B -0.8828
70 I B 0.0000
71 S B -0.5992
72 R B -1.1586
73 D B -1.8445
74 N B -2.2525
75 A B -1.6929
76 K B -2.4581
77 N B -1.9790
78 T B 0.0000
79 L B 0.0000
80 Y B -0.6022
81 L B 0.0000
82 Q B -1.2500
83 M B 0.0000
84 N B -1.4845
85 S B -1.4072
86 L B 0.0000
87 R B -2.9582
88 A B -2.0719
89 E B -2.4492
90 D B 0.0000
91 T B -1.0020
92 A B 0.0000
93 V B -0.1396
94 Y B 0.0000
95 Y B 0.0980
96 C B 0.0000
97 A B 0.0000
98 D B 0.0000
99 G B 0.0000
100 L B 2.5598
101 L B 3.1723
102 F B 2.7836
103 S B 1.2864
104 Y B 0.2893
105 D B -1.3452
106 D B -1.2876
107 W B -0.4133
108 G B -0.3554
109 Q B -0.9214
110 G B 0.0000
111 T B -0.6994
112 Q B -0.9618
113 V B 0.0000
114 T B -0.4043
115 V B 0.0000
116 S B -0.6843
117 S B -0.5213
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3146 5.13 View CSV PDB
4.5 -0.3469 5.1097 View CSV PDB
5.0 -0.3843 5.076 View CSV PDB
5.5 -0.4209 5.0332 View CSV PDB
6.0 -0.449 4.9861 View CSV PDB
6.5 -0.4639 4.9375 View CSV PDB
7.0 -0.4669 4.8885 View CSV PDB
7.5 -0.463 4.8394 View CSV PDB
8.0 -0.4549 4.7906 View CSV PDB
8.5 -0.4427 4.7428 View CSV PDB
9.0 -0.426 4.6978 View CSV PDB