Project name: 52859164a3792f3

Status: done

Started: 2026-04-16 15:29:46
Chain sequence(s) A: MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQPLCIRALLNLHT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/52859164a3792f3/tmp/folded.pdb                (00:05:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:16)
Show buried residues

Minimal score value
-4.3081
Maximal score value
2.8637
Average score
-0.7174
Total score value
-191.5485

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -1.9323
2 E A -3.0294
3 K A -3.1874
4 Y A 0.0000
5 E A -3.4215
6 R A -2.2680
7 I A -0.3862
8 R A -1.1711
9 V A 0.1922
10 V A 1.0667
11 G A -0.3566
12 R A -1.4577
13 G A -0.7536
14 A A 0.1611
15 F A 0.2982
16 G A -0.2609
17 I A -0.0141
18 V A 0.1453
19 H A 0.0000
20 L A 0.0000
21 C A 0.0000
22 L A -1.8840
23 R A -3.1111
24 K A -3.6517
25 A A -2.2497
26 D A -2.7366
27 Q A -2.9408
28 K A -2.0112
29 L A -0.7004
30 V A 0.0000
31 I A 0.0000
32 I A 0.0000
33 K A -0.0581
34 Q A -0.4018
35 I A 0.0000
36 P A -1.5508
37 V A 0.0000
38 E A -3.2821
39 Q A -2.7142
40 M A -2.6391
41 T A -2.8219
42 K A -3.7543
43 E A -3.8384
44 E A -3.6096
45 R A -4.3081
46 Q A -3.5947
47 A A 0.0000
48 A A 0.0000
49 Q A -2.5674
50 N A -2.1968
51 E A 0.0000
52 C A 0.0000
53 Q A -1.4810
54 V A -0.5891
55 L A -0.9593
56 K A -1.6707
57 L A -0.1251
58 L A 0.0000
59 N A -1.5299
60 H A -0.9209
61 P A -0.6441
62 N A 0.0000
63 V A 0.0000
64 I A 0.0000
65 E A -1.0922
66 Y A -0.7584
67 Y A -0.5327
68 E A -1.0912
69 N A -0.7639
70 F A 0.4883
71 L A 0.3743
72 E A -1.5715
73 D A -2.9445
74 K A -3.2056
75 A A 0.0000
76 L A 0.0000
77 M A 0.0000
78 I A 0.0000
79 A A 0.0000
80 M A -0.0976
81 E A -0.1988
82 Y A -0.0762
83 A A 0.0000
84 P A -0.9433
85 G A 0.0000
86 G A -0.8531
87 T A -1.0062
88 L A 0.0000
89 A A -1.5365
90 E A -2.3819
91 F A -1.6126
92 I A 0.0000
93 Q A -2.7947
94 K A -2.7589
95 R A -1.8098
96 C A -0.9123
97 N A -1.6742
98 S A -1.0479
99 L A -0.5980
100 L A 0.0000
101 E A -2.3610
102 E A -2.1530
103 E A -2.8652
104 T A -1.5202
105 I A 0.0000
106 L A 0.0000
107 H A -1.1656
108 F A 0.0000
109 F A 0.0000
110 V A 0.0000
111 Q A 0.0000
112 I A 0.0000
113 L A 0.0000
114 L A 0.0525
115 A A 0.0000
116 L A 0.0000
117 H A -0.3406
118 H A -0.4261
119 V A 0.0000
120 H A 0.0000
121 T A 0.0585
122 H A 0.3658
123 L A 1.1518
124 I A 0.0000
125 L A -0.0531
126 H A 0.0000
127 R A -0.9788
128 D A -1.2461
129 L A 0.0000
130 K A -1.0608
131 T A 0.0000
132 Q A -1.7363
133 N A 0.0000
134 I A 0.0000
135 L A -0.3597
136 L A 0.0000
137 D A 0.0000
138 K A -2.3295
139 H A -1.9643
140 R A -1.3727
141 M A -0.2737
142 V A -0.0528
143 V A 0.0000
144 K A -0.0643
145 I A 0.0000
146 G A 0.0000
147 D A -2.0427
148 F A 0.0000
149 G A 0.0000
150 I A 0.0000
151 S A -0.9117
152 K A -1.3426
153 I A 0.0082
154 L A -0.3447
155 S A -1.0688
156 S A -1.5001
157 K A -2.1237
158 S A -1.5136
159 K A -1.9196
160 A A -0.0484
161 Y A 1.6162
162 T A 1.6678
163 V A 2.8637
164 V A 2.4899
165 G A 0.8087
166 T A 0.0487
167 P A 0.1311
168 C A 0.0000
169 Y A -0.0302
170 I A 0.7708
171 S A 0.0000
172 P A 0.0000
173 E A 0.0000
174 L A -0.9775
175 C A -0.7094
176 E A -2.2742
177 G A -2.1866
178 K A -2.3647
179 P A -1.3029
180 Y A -0.5413
181 N A -1.1584
182 Q A -1.0675
183 K A -1.2187
184 S A 0.0000
185 D A 0.0000
186 I A 0.0000
187 W A 0.0000
188 A A 0.0000
189 L A 0.0000
190 G A 0.0000
191 C A 0.0000
192 V A 0.0000
193 L A 0.0000
194 Y A 0.0000
195 E A 0.0000
196 L A 0.0000
197 A A 0.0000
198 S A -0.8214
199 L A -1.4049
200 K A -2.5264
201 R A -1.9311
202 A A 0.0000
203 F A 0.0000
204 E A -2.3841
205 A A -1.0874
206 A A -0.8925
207 N A -1.3966
208 L A -0.0923
209 P A 0.0010
210 A A -0.1496
211 L A 0.0000
212 V A 0.5450
213 L A 1.4650
214 K A -0.0810
215 I A 0.0000
216 M A 0.5211
217 S A 0.2206
218 G A 0.0967
219 T A 0.0123
220 F A -0.1837
221 A A -0.2445
222 P A -0.3854
223 I A 0.0000
224 S A -1.6335
225 D A -2.8641
226 R A -2.9390
227 Y A 0.0000
228 S A -1.6690
229 P A -1.8557
230 E A -1.8657
231 L A 0.0000
232 R A -1.4983
233 Q A -1.4930
234 L A 0.0000
235 V A 0.0000
236 L A 0.5236
237 S A -0.0527
238 L A 0.0000
239 L A 0.0000
240 S A -0.3568
241 L A -0.3544
242 E A -1.6741
243 P A -1.2918
244 A A -1.0283
245 Q A -1.6517
246 R A 0.0000
247 P A -0.7707
248 P A -0.9027
249 L A 0.0000
250 S A -0.7512
251 H A -1.1867
252 I A 0.0000
253 M A -0.3589
254 A A -0.4842
255 Q A -0.9404
256 P A -0.6696
257 L A 0.0000
258 C A 0.0000
259 I A 0.3004
260 R A -1.3769
261 A A -0.9286
262 L A 0.1846
263 L A 0.4655
264 N A -1.1424
265 L A -0.2856
266 H A -0.6264
267 T A -0.3960
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7695 2.9352 View CSV PDB
4.5 -0.823 2.9352 View CSV PDB
5.0 -0.8862 2.9352 View CSV PDB
5.5 -0.9426 2.9352 View CSV PDB
6.0 -0.9757 2.9352 View CSV PDB
6.5 -0.9748 2.9352 View CSV PDB
7.0 -0.9425 2.9352 View CSV PDB
7.5 -0.8907 2.9352 View CSV PDB
8.0 -0.8294 2.9351 View CSV PDB
8.5 -0.7629 2.9348 View CSV PDB
9.0 -0.6931 2.9341 View CSV PDB