Project name: f05 mutant 4 antibody

Status: done

Started: 2026-03-17 06:28:46
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCRVSQNVSSNLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVKLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISASGATTYYADPVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:00)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:05)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:41)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/53481009983e75a/tmp/folded.pdb                (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:54)
Show buried residues

Minimal score value
-3.0454
Maximal score value
1.343
Average score
-0.7346
Total score value
-181.4388

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7375
2 I A 0.0000
3 V A 0.6949
4 L A 0.0000
5 T A -0.7106
6 Q A -0.6695
7 S A -0.7282
8 P A -0.3239
9 A A -0.3217
10 T A -0.4323
11 L A -0.4120
12 S A -0.7887
13 L A -1.1385
14 S A -1.7469
15 P A -2.0006
16 G A -1.8851
17 E A -2.4585
18 R A -2.7773
19 A A 0.0000
20 T A -0.6633
21 L A 0.0000
22 S A -1.0799
23 C A 0.0000
24 R A -2.7125
25 V A 0.0000
26 S A -1.3463
27 Q A -2.5561
28 N A -2.7465
29 V A 0.0000
30 S A -1.3690
31 S A -1.1002
32 N A -1.4077
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.3993
40 P A -0.9238
41 G A -1.3568
42 Q A -1.9668
43 A A -1.4591
44 P A 0.0000
45 R A -1.7737
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A -1.1124
51 T A 0.0000
52 S A -1.1978
53 N A -1.5781
54 R A -1.6110
55 A A 0.0000
56 T A -0.8323
57 G A -0.7076
58 I A -0.6755
59 P A -0.4049
60 A A -0.4020
61 R A -0.9103
62 F A 0.0000
63 S A -0.6914
64 G A -0.7965
65 S A -0.9697
66 G A -1.1916
67 P A -1.3178
68 G A -1.8404
69 T A -2.4339
70 D A -3.0454
71 F A 0.0000
72 T A -0.9700
73 L A 0.0000
74 T A -0.6455
75 I A 0.0000
76 S A -1.5612
77 S A -1.8679
78 L A 0.0000
79 E A -2.3185
80 P A -2.1477
81 E A -2.3858
82 D A 0.0000
83 F A -0.7136
84 A A 0.0000
85 V A -0.1262
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A -1.2372
92 R A -2.5881
93 N A -1.8528
94 W A -0.7296
95 P A -0.9287
96 L A 0.0000
97 T A 0.0000
98 F A 0.1481
99 G A 0.0000
100 G A -0.7540
101 G A -0.6871
102 T A 0.0000
103 K A -0.7946
104 V A 0.0000
105 E A -1.1052
106 I A -1.7794
107 K A -2.1836
108 G A -1.7929
109 G A -1.8308
110 G A -1.4332
111 G A -1.2106
112 S A -1.1515
113 G A -1.4505
114 G A -1.5708
115 G A -1.2386
116 G A -1.6061
117 S A -1.1051
118 G A -1.2300
119 G A -1.2981
120 G A -1.4416
121 G A -1.6796
122 S A -1.6688
123 E A -2.4506
124 V A -1.6102
125 K A -1.8115
126 L A 0.0000
127 V A 0.1012
128 E A 0.0000
129 S A -0.3738
130 G A -0.6901
131 G A 0.0804
132 G A 0.5801
133 L A 1.2914
134 V A 0.0000
135 Q A -1.4112
136 P A -1.5857
137 G A -1.3932
138 G A -0.9636
139 S A -1.2084
140 L A -0.7475
141 R A -1.7471
142 L A 0.0000
143 S A -0.4462
144 C A 0.0000
145 A A -0.3587
146 A A 0.0000
147 S A -0.9052
148 G A -1.2504
149 F A -1.0015
150 T A -0.7052
151 F A 0.0000
152 S A -1.6156
153 R A -2.1633
154 Y A 0.0000
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6766
162 A A -1.0671
163 P A -0.8557
164 G A -1.4472
165 K A -2.2695
166 G A -1.3674
167 L A 0.0000
168 E A -0.9590
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 S A 0.0000
173 I A 0.0000
174 S A -0.2044
175 A A -0.7730
176 S A -0.8163
177 G A -0.4678
178 A A -0.1291
179 T A -0.0277
180 T A 0.1508
181 Y A 0.1035
182 Y A -0.6203
183 A A 0.0000
184 D A -2.5513
185 P A -1.7717
186 V A 0.0000
187 K A -2.5303
188 G A -1.7156
189 R A -1.2890
190 F A 0.0000
191 T A -0.7621
192 I A 0.0000
193 S A -0.4205
194 R A -1.0040
195 D A -1.6366
196 N A -1.9075
197 S A -1.6033
198 K A -2.3899
199 N A -1.7352
200 T A -1.0934
201 L A 0.0000
202 Y A -0.4870
203 L A 0.0000
204 Q A -1.1767
205 M A 0.0000
206 N A -1.3598
207 S A -1.2174
208 L A 0.0000
209 R A -2.1623
210 A A -1.6678
211 E A -2.1869
212 D A 0.0000
213 T A -0.4180
214 A A 0.0000
215 V A 0.5964
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -1.9014
224 F A -0.5475
225 D A -0.9111
226 I A 1.1685
227 L A 0.6006
228 T A 0.5237
229 G A 0.4363
230 Y A 1.1047
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -1.0594
236 P A -1.2721
237 W A 0.0000
238 G A 0.0000
239 Q A -1.4564
240 G A -0.3194
241 T A 0.3108
242 L A 1.3430
243 V A 0.0000
244 T A 0.2164
245 V A 0.0000
246 S A -0.7239
247 S A -0.6962
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5828 3.2422 View CSV PDB
4.5 -0.6224 2.9974 View CSV PDB
5.0 -0.6689 2.7394 View CSV PDB
5.5 -0.7158 2.477 View CSV PDB
6.0 -0.7551 2.2135 View CSV PDB
6.5 -0.7802 1.9921 View CSV PDB
7.0 -0.7899 1.9921 View CSV PDB
7.5 -0.7881 1.9921 View CSV PDB
8.0 -0.7784 1.9921 View CSV PDB
8.5 -0.7615 1.9921 View CSV PDB
9.0 -0.7382 1.9921 View CSV PDB