Project name: ValAla_R4

Status: done

Started: 2026-08-20 09:17:48
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSVRASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/54459815c198824/tmp/folded.pdb                (00:02:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:43)
Show buried residues

Minimal score value
-2.6856
Maximal score value
1.9699
Average score
-0.5478
Total score value
-135.8616

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5895
2 V A 0.0000
3 Q A -1.6941
4 L A 0.0000
5 Q A -1.7674
6 E A 0.0000
7 S A -0.6879
8 G A -0.3745
9 P A 0.0422
10 G A 0.3864
11 L A 0.9725
12 V A 0.0000
13 K A -1.8270
14 P A -1.3291
15 S A -1.4087
16 Q A -1.9459
17 T A -1.6074
18 L A 0.0000
19 S A -1.0026
20 L A 0.0000
21 T A -0.6267
22 V A 0.0000
23 T A -1.1775
24 V A 0.0000
25 S A -1.2675
26 G A -1.3276
27 G A -1.0263
28 S A -0.7047
29 I A 0.0000
30 S A -0.2207
31 S A -0.2732
32 G A -0.0106
33 D A 0.0919
34 Y A 0.6165
35 Y A 0.6099
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.3992
41 Q A 0.0000
42 P A -0.7938
43 P A -0.6925
44 G A -1.1238
45 C A -1.2405
46 K A -2.0894
47 G A -1.2409
48 L A 0.0000
49 E A -0.8185
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1251
54 I A 0.0000
55 Y A 0.3261
56 Y A 0.3559
57 S A -0.0812
58 G A -0.2314
59 S A -0.2612
60 T A -0.2557
61 D A -0.7159
62 Y A -0.7038
63 N A -0.8785
64 P A -1.2190
65 S A -1.1754
66 L A 0.0000
67 K A -2.0884
68 S A -1.4050
69 R A -1.6514
70 V A 0.0000
71 T A -1.1038
72 M A 0.0000
73 S A -0.3862
74 V A -0.3571
75 D A -1.2022
76 T A -1.0148
77 S A -1.3309
78 K A -2.1717
79 N A -1.4378
80 Q A -1.2500
81 F A 0.0000
82 S A -0.5585
83 L A 0.0000
84 K A -1.6345
85 V A 0.0000
86 N A -1.7351
87 S A -1.5145
88 V A 0.0000
89 T A -0.6766
90 A A -0.3734
91 A A -0.1875
92 D A 0.0000
93 T A 0.2739
94 A A 0.0000
95 V A 0.1923
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.5071
104 F A 1.9699
105 G A 0.7035
106 V A 0.4440
107 G A 0.6295
108 T A 0.0000
109 F A 0.0000
110 D A -0.4037
111 Y A -0.2899
112 W A -0.6303
113 G A 0.0000
114 Q A -1.5843
115 G A -0.7676
116 T A -0.1885
117 L A 0.8495
118 V A 0.0000
119 T A 0.3496
120 V A 0.0000
121 S A -0.3726
122 S A -0.7849
123 A A -0.6520
124 A A -0.3680
125 G A -0.8442
126 G A -1.0927
127 G A -1.1542
128 G A -1.2075
129 S A -1.0273
130 G A -1.1791
131 G A -1.2024
132 G A -1.3702
133 G A -1.2288
134 S A -1.0645
135 G A -1.2308
136 G A -1.3646
137 G A -1.2336
138 G A -1.1898
139 S A -0.7246
140 D A -0.5976
141 I A 0.0462
142 V A 1.0938
143 M A 0.0000
144 T A -0.5693
145 Q A -0.6460
146 S A -0.7261
147 P A -0.3521
148 A A -0.3856
149 T A -0.5385
150 L A -0.2812
151 S A -0.4289
152 L A -0.7012
153 S A -1.0077
154 P A -1.5235
155 G A -1.8155
156 E A -2.4142
157 R A -2.6856
158 A A 0.0000
159 T A -0.6581
160 L A 0.0000
161 S A -0.8732
162 V A 0.0000
163 R A -2.3261
164 A A 0.0000
165 S A -0.8032
166 Q A -1.5258
167 S A -1.2350
168 V A 0.0000
169 S A -0.5182
170 S A -0.3216
171 Y A 0.5971
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5058
179 P A -1.0110
180 G A -1.0111
181 C A -1.1603
182 Q A -1.5966
183 A A -1.1290
184 P A 0.0000
185 R A -1.1774
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.6213
190 D A -0.7720
191 A A 0.0000
192 S A -1.2054
193 N A -1.8169
194 R A -1.8251
195 A A -1.0807
196 T A -0.6937
197 G A -0.6836
198 I A 0.0000
199 P A -0.4845
200 A A -0.4104
201 R A -0.7216
202 F A 0.0000
203 S A -0.7768
204 G A 0.0000
205 S A -0.8536
206 G A -1.1121
207 S A -0.9578
208 G A -1.0540
209 T A -1.7498
210 D A -2.1547
211 F A 0.0000
212 T A -0.7542
213 L A 0.0000
214 T A -0.5850
215 I A 0.0000
216 S A -1.3454
217 S A -1.7288
218 L A 0.0000
219 E A -2.2884
220 P A -1.4992
221 E A -2.3304
222 D A 0.0000
223 F A -0.7780
224 A A 0.0000
225 V A -0.6810
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1662
233 S A -0.2525
234 T A -0.3700
235 P A -0.4145
236 L A 0.0000
237 T A 0.1908
238 F A 0.2487
239 G A 0.0000
240 G A -0.7897
241 G A -0.7754
242 T A 0.0000
243 K A -1.0185
244 A A 0.0000
245 E A -0.5522
246 I A 0.6531
247 K A -0.9195
248 A A -0.3637
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5115 4.9077 View CSV PDB
4.5 -0.5308 4.906 View CSV PDB
5.0 -0.5533 4.901 View CSV PDB
5.5 -0.5734 4.8883 View CSV PDB
6.0 -0.5845 4.8633 View CSV PDB
6.5 -0.5824 4.8268 View CSV PDB
7.0 -0.5672 4.784 View CSV PDB
7.5 -0.5433 4.7385 View CSV PDB
8.0 -0.5146 4.6921 View CSV PDB
8.5 -0.4827 4.6455 View CSV PDB
9.0 -0.4483 4.599 View CSV PDB