Project name: mi2699_2VY0_25C_conf5

Status: done

Started: 2026-05-22 14:59:48
Chain sequence(s) A: VPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:08:03)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/56387fce50ab151/tmp/folded.pdb                (00:08:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:13:59)
Show buried residues

Minimal score value
-3.1695
Maximal score value
1.8185
Average score
-0.6278
Total score value
-165.1201

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
35 V A 1.3064
36 P A 0.2377
37 E A -0.5403
38 V A 0.7181
39 I A -0.2767
40 E A -1.5767
41 I A -1.1922
42 D A -1.2038
43 G A -1.4446
44 K A -1.2132
45 Q A -0.7863
46 W A 0.0000
47 R A -0.2409
48 L A 0.0000
49 I A 1.3351
50 W A 0.0000
51 H A -0.1520
52 D A -0.9078
53 E A -1.1438
54 F A 0.0000
55 E A -2.6117
56 G A -2.0755
57 S A -1.5539
58 E A -2.2458
59 V A -1.6907
60 N A -2.0101
61 K A -2.9227
62 E A -2.7430
63 Y A -1.6211
64 W A 0.0000
65 T A -1.3236
66 F A 0.0000
67 E A -1.1842
68 K A -1.2514
69 G A -0.7311
70 N A 0.0000
71 G A 0.0000
72 I A 0.7240
73 A A 0.6690
74 Y A 1.3586
75 G A 0.7203
76 I A 0.8497
77 P A 0.0260
78 G A 0.0000
79 W A -0.3811
80 G A -0.9473
81 N A -1.7218
82 G A -1.3353
83 E A -1.1760
84 L A 0.8010
85 E A 0.2857
86 Y A 0.2923
87 Y A 0.0000
88 T A -1.7134
89 E A -2.5771
90 N A -2.0715
91 N A 0.0000
92 T A 0.0000
93 Y A -0.0833
94 I A -0.3551
95 V A -0.3088
96 N A -1.4135
97 G A -1.5145
98 T A 0.0000
99 L A 0.0000
100 V A 0.0000
101 I A 0.0000
102 E A 0.0000
103 A A 0.0000
104 R A -1.2909
105 K A -1.5362
106 E A -1.1118
107 I A 1.7611
108 I A 1.3995
109 T A 0.1580
110 D A -1.3285
111 P A -1.4224
112 N A -1.9717
113 E A -1.5400
114 G A -0.7654
115 T A 0.4139
116 F A 0.0000
117 L A 1.8185
118 Y A 0.7204
119 T A 0.0000
120 S A 0.0000
121 S A 0.0000
122 R A -0.9427
123 L A 0.0000
124 K A -0.4825
125 T A 0.0000
126 E A -1.1349
127 G A -1.5108
128 K A -2.1966
129 V A -1.4271
130 E A -1.8749
131 F A 0.0000
132 S A -1.0690
133 P A -0.7678
134 P A -0.2102
135 V A 0.0000
136 V A 0.0000
137 V A 0.0000
138 E A -0.3961
139 A A 0.0000
140 R A -1.1327
141 I A 0.0000
142 K A -1.4260
143 L A 0.0000
144 P A 0.0000
145 K A -2.4713
146 G A -1.8374
147 K A -2.3186
148 G A 0.0000
149 L A 0.0000
150 W A 0.1208
151 P A 0.0000
152 A A 0.0000
153 F A 0.0000
154 W A -0.0365
155 M A 0.0000
156 L A -0.0388
157 G A 0.0000
158 S A -0.9951
159 N A -0.9022
160 I A -0.5820
161 R A -1.9924
162 E A -1.7928
163 V A 0.3956
164 G A 0.0694
165 W A 0.7345
166 P A 0.3653
167 N A -0.5122
168 C A 0.0000
169 G A 0.0000
170 E A -0.3222
171 I A 0.0000
172 D A -0.2921
173 I A 0.0000
174 M A 0.0000
175 E A -0.2627
176 F A 0.0000
177 L A 0.0000
178 G A -1.4710
179 H A -1.8448
180 E A -1.9836
181 P A -1.8426
182 R A -1.6150
183 T A -0.8660
184 I A 0.0000
185 H A -0.6792
186 G A 0.0000
187 T A 0.0000
188 V A 0.0000
189 H A -0.8465
190 G A 0.0000
191 P A -0.8709
192 G A -0.8924
193 Y A 0.0000
194 S A -1.1847
195 G A -1.2803
196 S A -1.2723
197 K A -2.0173
198 G A -1.3351
199 I A -0.8368
200 T A -1.2916
201 R A -1.6143
202 A A -0.6933
203 Y A -0.3378
204 T A -0.7504
205 L A 0.0000
206 P A -1.1985
207 E A -2.1461
208 G A -1.2222
209 V A -0.4462
210 P A -1.3831
211 D A -2.3741
212 F A 0.0000
213 T A -2.3203
214 E A -3.0968
215 D A -2.4464
216 F A -0.7865
217 H A 0.0000
218 V A -0.7899
219 F A 0.0000
220 G A 0.0000
221 I A 0.0000
222 V A 0.0000
223 W A 0.0000
224 Y A -0.7543
225 P A -1.5779
226 D A -2.0605
227 K A -2.1482
228 I A 0.0000
229 K A -1.1047
230 W A 0.0000
231 Y A 0.0000
232 V A 0.0000
233 D A -1.9761
234 G A -1.1966
235 T A -0.5658
236 F A -0.3504
237 Y A 0.0000
238 H A 0.0000
239 E A -2.1180
240 V A 0.0000
241 T A -2.2052
242 K A -2.9526
243 E A -3.1695
244 Q A -2.1622
245 V A 0.0000
246 E A -2.9725
247 A A -1.4718
248 M A -0.3325
249 G A -1.2404
250 Y A -1.2855
251 E A -2.3113
252 W A 0.0000
253 V A 0.0000
254 F A 0.0000
255 D A -2.3559
256 K A -1.6014
257 P A -1.2728
258 F A 0.0000
259 Y A 0.0000
260 I A 0.0000
261 I A 0.0000
262 L A 0.0000
263 N A -0.2333
264 L A 0.0000
265 A A 0.0000
266 V A -0.2789
267 G A 0.0000
268 G A 0.0997
269 Y A 1.2374
270 W A 1.1436
271 P A 0.0000
272 G A -0.5400
273 N A -1.5901
274 P A -1.8402
275 D A -2.0715
276 A A -0.9627
277 T A -0.6895
278 T A 0.0000
279 P A -1.0384
280 F A -0.9356
281 P A -1.1752
282 A A 0.0000
283 K A -1.1965
284 M A 0.0000
285 V A -0.2734
286 V A 0.0000
287 D A -1.0458
288 Y A 0.0000
289 V A 0.0000
290 R A 0.0000
291 V A 0.0000
292 Y A 0.0000
293 S A 0.8538
294 F A 1.0208
295 V A 1.1214
296 S A -0.1793
297 G A -0.7689
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.1399 3.3976 View CSV PDB
4.5 -0.2136 3.367 View CSV PDB
5.0 -0.3101 3.3169 View CSV PDB
5.5 -0.4124 3.2545 View CSV PDB
6.0 -0.5018 3.1899 View CSV PDB
6.5 -0.5625 3.1332 View CSV PDB
7.0 -0.5887 3.1271 View CSV PDB
7.5 -0.5883 3.1307 View CSV PDB
8.0 -0.5732 3.1317 View CSV PDB
8.5 -0.5499 3.1312 View CSV PDB
9.0 -0.5208 3.1284 View CSV PDB