Project name: 566c955f4a902d0

Status: done

Started: 2026-06-26 08:46:45
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MRLRKLGDSFFKPP
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/566c955f4a902d0/tmp/folded.pdb                (00:02:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:49)
Show buried residues

Minimal score value
-3.6921
Maximal score value
1.2065
Average score
-0.736
Total score value
-170.754

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
217 R A -0.1675
218 S A 0.0000
219 V A 0.0000
220 A A -0.0750
221 S A -0.4336
222 S A -0.5705
223 K A -1.2175
224 L A 0.0000
225 W A 0.1415
226 M A 0.0000
227 L A -0.0463
228 E A -0.4948
229 F A 0.0000
230 S A 0.0000
231 A A -0.0706
232 F A 0.0000
233 L A 0.0000
234 E A -1.6400
235 Q A -1.9058
236 Q A -2.0138
237 Q A -2.3580
238 D A -1.8815
239 P A -1.5660
240 D A -2.2193
241 T A -1.3961
242 Y A -0.9342
243 N A -2.2483
244 K A -2.2934
245 H A -1.5142
246 L A -0.5738
247 F A 0.0000
248 V A 0.0000
249 H A -0.4603
250 I A 0.0000
251 G A -0.6910
252 Q A -1.0781
253 S A -0.8198
254 S A -0.6356
255 P A -0.4105
256 S A 0.0757
257 Y A 0.9144
258 S A 0.4453
259 D A 0.1206
260 P A 0.1545
261 Y A 0.9355
262 L A 0.1032
263 E A -0.4092
264 A A -0.6367
265 V A 0.0000
266 D A -1.8316
267 I A 0.0000
268 R A -3.2748
269 Q A -2.2412
270 I A 0.0000
271 Y A -1.9007
272 D A -2.1237
273 K A -1.0443
274 F A 0.0000
275 P A -2.1755
276 E A -3.1737
277 K A -3.4088
278 K A -3.1784
279 G A -2.4895
280 G A 0.0000
281 L A 0.0000
282 K A -3.6921
283 D A -3.2257
284 L A -2.3603
285 F A 0.0000
286 E A -3.4449
287 R A -3.1057
288 G A 0.0000
289 P A -1.2198
290 S A -1.2314
291 N A -0.7365
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A 0.0000
300 A A 0.0000
301 D A -0.8469
302 L A 0.0000
303 N A -1.5725
304 T A 0.0000
305 N A -1.6303
306 I A -0.8676
307 E A -2.2192
308 D A -2.5840
309 E A 0.0000
310 G A -1.4062
311 S A -1.6038
312 S A -1.0712
313 F A -0.3759
314 Y A 0.0000
315 G A 0.0000
316 V A -0.4296
317 S A 0.0000
318 S A 0.0000
319 Q A -0.6378
320 Y A 0.0000
321 E A -1.0523
322 S A 0.0000
323 P A -1.3903
324 E A -2.0215
325 N A -1.8171
326 M A -1.1167
327 I A -0.3557
328 I A 0.0000
329 T A -0.2083
330 C A 0.0000
331 S A 0.3540
332 T A 0.0288
333 K A -0.3253
334 V A 0.0000
335 C A 0.0000
336 S A 0.1961
337 F A 0.7833
338 G A 0.0000
339 K A -1.5644
340 Q A -0.7421
341 V A 0.7943
342 V A 0.2115
343 E A -0.0193
344 K A 0.1435
345 V A 1.2065
346 E A 0.2448
347 T A -0.0186
348 E A -0.4536
349 Y A 0.5320
350 A A -0.7213
351 R A -1.5956
352 Y A -0.5601
353 E A -1.3687
354 N A -1.8196
355 G A -1.2546
356 H A -1.8333
357 Y A -1.2594
358 S A 0.0000
359 Y A 0.0000
360 R A -1.3913
361 I A -1.1803
362 H A -1.7937
363 R A -1.9136
364 S A -1.1191
365 P A -0.7999
366 L A -0.3418
367 C A -0.6154
368 E A -1.4564
369 Y A -0.1629
370 M A -0.3323
371 I A -0.6342
372 N A -1.2150
373 F A -0.8804
374 I A 0.0000
375 H A -1.1987
376 K A -2.1169
377 L A 0.0000
378 K A -1.5432
379 H A -1.5457
380 L A -0.8395
381 P A -0.7372
382 E A -0.9130
383 K A -0.3835
384 Y A 0.8831
385 M A 0.5376
386 M A -0.0646
387 N A 0.1144
388 S A 0.3360
389 V A 0.4393
390 L A 0.0000
391 E A -0.5959
392 N A -0.1433
393 F A 0.0000
394 T A 0.0000
395 I A 0.0217
396 L A 0.0000
397 Q A 0.0000
398 V A 0.3621
399 V A 0.0000
400 T A -1.0042
401 N A -1.6111
402 R A -2.1451
403 D A -2.5888
404 T A -1.8983
405 Q A -2.4273
406 E A -2.0898
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A 0.0000
415 F A 0.0000
416 E A 0.0000
417 V A 0.0000
418 S A 0.0000
419 A A -0.8478
420 S A -1.3990
421 E A -2.3842
422 H A -2.0142
423 G A -1.4568
424 A A 0.0000
425 Q A -0.9563
426 H A -0.4708
427 H A -0.2364
428 I A 0.0000
429 Y A 0.0000
430 R A -0.5714
431 L A 0.0000
432 V A -1.4287
433 K A -3.2142
434 E A -2.9394
1 M B -1.0415
2 R B -2.5716
3 L B 0.0000
4 R B -1.5174
5 K B -2.1508
6 L B -0.9167
7 G B 0.0000
8 D B -1.0095
9 S B -0.6554
10 F B 0.1967
11 F B 0.4002
12 K B -1.2051
13 P B -0.7814
14 P B -0.6168
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7371 2.8205 View CSV PDB
4.5 -0.8009 2.7373 View CSV PDB
5.0 -0.8749 2.6433 View CSV PDB
5.5 -0.9416 2.5569 View CSV PDB
6.0 -0.983 2.5007 View CSV PDB
6.5 -0.9885 2.4942 View CSV PDB
7.0 -0.964 2.5343 View CSV PDB
7.5 -0.9244 2.7231 View CSV PDB
8.0 -0.8785 2.9571 View CSV PDB
8.5 -0.8277 3.1899 View CSV PDB
9.0 -0.7715 3.4161 View CSV PDB