Project name: 57506679eb5b69c

Status: done

Started: 2025-08-07 01:38:23
Chain sequence(s) A: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/57506679eb5b69c/tmp/folded.pdb                (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:35)
Show buried residues

Minimal score value
-3.1551
Maximal score value
1.6728
Average score
-0.7857
Total score value
-194.8644

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.1004
2 V A -1.1827
3 Q A -1.3015
4 L A 0.0000
5 V A 0.7475
6 E A 0.0000
7 S A -0.2931
8 G A -0.6226
9 G A 0.1269
10 G A 0.6702
11 L A 1.3310
12 V A -0.5303
13 Q A -1.9472
14 P A -2.2509
15 G A -2.3157
16 R A -2.8006
17 S A -2.1429
18 L A -1.3946
19 R A -2.1275
20 L A 0.0000
21 S A -0.4410
22 C A 0.0000
23 A A -0.2047
24 A A 0.0000
25 S A -1.0441
26 G A -1.2291
27 F A -0.8412
28 T A -1.0294
29 F A 0.0000
30 D A -2.4850
31 D A -2.1639
32 Y A -0.8229
33 A A 0.0000
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.5989
40 A A -1.0407
41 P A -1.0304
42 G A -1.4792
43 K A -2.3636
44 G A -1.5963
45 L A 0.0000
46 E A -1.0517
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 A A 0.0000
51 I A 0.0000
52 T A -0.8119
53 W A -1.3524
54 N A -1.9121
55 S A -1.1933
56 G A -1.0978
57 H A -0.9904
58 I A 0.1116
59 D A -0.4386
60 Y A -0.8405
61 A A 0.0000
62 D A -2.7631
63 S A -1.8301
64 V A 0.0000
65 E A -2.7890
66 G A -1.8515
67 R A -1.6024
68 F A 0.0000
69 T A -0.7860
70 I A 0.0000
71 S A -0.2535
72 R A -1.2328
73 D A -1.9031
74 N A -2.3044
75 A A -1.5961
76 K A -2.3015
77 N A -1.9238
78 S A 0.0000
79 L A 0.0000
80 Y A -0.6153
81 L A 0.0000
82 Q A -1.2465
83 M A 0.0000
84 N A -1.9679
85 S A -1.9881
86 L A 0.0000
87 R A -3.1551
88 A A -2.0245
89 E A -2.4587
90 D A 0.0000
91 T A -0.4848
92 A A 0.0000
93 V A 0.7378
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 K A 0.0000
99 V A 0.0000
100 S A 0.3541
101 Y A 0.7665
102 L A 0.7773
103 S A 0.1845
104 T A 0.0955
105 A A 0.0000
106 S A 0.0510
107 S A 0.0000
108 L A 0.0000
109 D A -0.0898
110 Y A 0.0251
111 W A -0.3419
112 G A 0.0000
113 Q A -1.3244
114 G A 0.0000
115 T A 0.5730
116 L A 1.6728
117 V A 0.0000
118 T A 0.2578
119 V A 0.0000
120 S A -0.7161
121 S A -0.9300
122 G A -0.9554
123 G A -1.1214
124 G A -1.1246
125 G A -1.0914
126 S A -0.9713
127 G A -1.0697
128 G A -1.1374
129 G A -1.1760
130 G A -1.1460
131 S A -1.0124
132 G A -1.1656
133 G A -1.2207
134 G A -1.2045
135 G A -1.2274
136 S A -1.0547
137 G A -1.3931
138 G A -1.6727
139 G A -1.3400
140 G A -1.6534
141 S A -1.4620
142 D A -2.1366
143 I A -1.8569
144 Q A -2.0919
145 M A 0.0000
146 T A -1.4673
147 Q A 0.0000
148 S A -0.8468
149 P A -0.6443
150 S A -0.9635
151 S A -1.2654
152 L A -0.9800
153 S A -1.2501
154 A A -1.1140
155 S A -0.7541
156 V A 0.2049
157 G A -0.6810
158 D A -1.5605
159 R A -2.2627
160 V A 0.0000
161 T A -0.5910
162 I A 0.0000
163 T A -0.9440
164 C A 0.0000
165 R A -3.0296
166 A A 0.0000
167 S A -2.0372
168 Q A -2.5220
169 G A -2.2080
170 I A 0.0000
171 R A -2.7273
172 N A -1.8132
173 Y A -0.9856
174 L A 0.0000
175 A A 0.0000
176 W A 0.0000
177 Y A 0.0000
178 Q A 0.0000
179 Q A 0.0000
180 K A -1.9044
181 P A -1.2552
182 G A -1.7390
183 K A -2.6520
184 A A -1.6486
185 P A 0.0000
186 K A -1.6412
187 L A 0.0000
188 L A 0.0000
189 I A 0.0000
190 Y A 0.1929
191 A A -0.3396
192 A A 0.0000
193 S A -0.3060
194 T A 0.0611
195 L A 0.1911
196 Q A -0.3575
197 S A -0.4161
198 G A -0.5995
199 V A 0.0000
200 P A -0.4770
201 S A -0.4858
202 R A -0.8175
203 F A 0.0000
204 S A -0.3059
205 G A 0.0000
206 S A -0.7944
207 G A -1.5811
208 S A -1.9778
209 G A -2.3296
210 T A -2.5948
211 D A -3.1153
212 F A 0.0000
213 T A -0.8754
214 L A 0.0000
215 T A -0.5836
216 I A 0.0000
217 S A -1.3085
218 S A -1.0556
219 L A 0.0000
220 Q A -0.8764
221 P A -1.0458
222 E A -2.0857
223 D A 0.0000
224 V A -1.1450
225 A A 0.0000
226 T A -1.1954
227 Y A 0.0000
228 Y A 0.0000
229 C A 0.0000
230 Q A 0.0000
231 R A 0.0000
232 Y A 0.0000
233 N A -1.5493
234 R A -2.1080
235 A A -1.0935
236 P A -1.1484
237 Y A 0.0000
238 T A -0.9524
239 F A 0.0000
240 G A 0.0000
241 Q A -1.7244
242 G A 0.0000
243 T A 0.0000
244 K A -2.3157
245 V A 0.0000
246 E A -2.3142
247 I A -1.1161
248 K A -1.6831
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7308 2.0908 View CSV PDB
4.5 -0.7708 2.0908 View CSV PDB
5.0 -0.8173 2.0908 View CSV PDB
5.5 -0.8628 2.0908 View CSV PDB
6.0 -0.8996 2.0908 View CSV PDB
6.5 -0.9218 2.0908 View CSV PDB
7.0 -0.9298 2.0908 View CSV PDB
7.5 -0.9292 2.0908 View CSV PDB
8.0 -0.924 2.0908 View CSV PDB
8.5 -0.9144 2.0908 View CSV PDB
9.0 -0.8989 2.0908 View CSV PDB