Project name: fold_rfa148_b3v_a5v_b39s_fv84b_b27vq [mutate: VC93B] [mutate: GA54B]

Status: done

Started: 2026-06-24 08:17:31
Chain sequence(s) A: EVQLAESGGGLEQPGGSLRLSCAGSGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSS
B: DIAMTQSPLSLPVTPGEPASISCRSSQETSAIGWYLQKPGQSPQLLIYGTSTRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTGCPGTFGQGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues GA54B
Energy difference between WT (input) and mutated protein (by FoldX) -0.917225 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:54)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:57)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/57fb1fbe11f6897/tmp/folded.pdb                (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:48)
Show buried residues

Minimal score value
-3.051
Maximal score value
0.9581
Average score
-0.8119
Total score value
-188.3669

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9147
2 V A -0.8023
3 Q A -1.4793
4 L A 0.0000
5 A A -0.5694
6 E A 0.0000
7 S A -0.8014
8 G A -0.9900
9 G A -0.5053
10 G A 0.0938
11 L A 0.9017
12 E A -0.6407
13 Q A -1.5846
14 P A -1.7830
15 G A -1.3991
16 G A -1.0641
17 S A -1.3581
18 L A -1.0952
19 R A -1.9964
20 L A 0.0000
21 S A -0.6430
22 C A 0.0000
23 A A -0.7006
24 G A 0.0000
25 S A -0.9710
26 G A -1.0584
27 F A -0.4096
28 T A -0.2245
29 F A 0.0000
30 S A -1.2410
31 S A -0.6402
32 Q A -0.8898
33 G A -0.8397
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8504
40 A A -1.2437
41 P A -1.0086
42 G A -1.4468
43 K A -2.3726
44 G A -1.5801
45 L A 0.0000
46 E A -1.0746
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.3542
51 I A 0.0000
52 S A -0.7503
53 A A -1.2385
54 D A -2.2072
55 G A -1.4160
56 S A -0.9033
57 G A -0.3849
58 T A 0.3591
59 Y A 0.8127
60 Y A -0.2919
61 A A 0.0000
62 D A -2.3892
63 S A -1.7545
64 V A 0.0000
65 K A -2.4851
66 G A -1.7530
67 R A -1.5305
68 F A 0.0000
69 T A -0.7305
70 I A 0.0000
71 S A -0.4659
72 R A -1.2922
73 D A -1.8503
74 N A -2.0719
75 S A -1.6559
76 K A -2.4314
77 N A -1.8227
78 T A -1.2373
79 L A 0.0000
80 Y A -0.5520
81 L A 0.0000
82 Q A -1.2943
83 M A 0.0000
84 N A -1.4054
85 S A -1.1573
86 L A 0.0000
87 R A -2.2020
88 A A -1.7157
89 E A -2.1905
90 D A 0.0000
91 T A -0.7081
92 A A 0.0000
93 V A -0.0230
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.4544
99 L A 0.0000
100 S A -0.9417
101 R A -2.5187
102 V A 0.0000
103 R A -2.7418
104 V A -1.0199
105 G A -1.0678
106 S A -1.0992
107 T A -1.7520
108 R A -2.8656
109 G A 0.0000
110 V A -0.9827
111 V A 0.0000
112 G A 0.0000
113 D A -0.6566
114 V A -0.2585
115 W A -0.5014
116 G A 0.0000
117 Q A -1.6021
118 G A 0.0000
119 T A -0.4346
120 T A -0.0615
121 V A 0.0000
122 T A -0.2003
123 V A 0.0000
124 S A -0.8437
125 S A -0.7425
1 D B -1.7334
2 I B -1.1940
3 A B -1.0139
4 M B 0.0000
5 T B -0.9696
6 Q B 0.0000
7 S B -0.2289
8 P B 0.2161
9 L B 0.9581
10 S B 0.0844
11 L B -0.2621
12 P B -1.2788
13 V B 0.0000
14 T B -1.9656
15 P B -1.9566
16 G B -1.9101
17 E B -2.3790
18 P B -2.1166
19 A B 0.0000
20 S B -0.6835
21 I B 0.0000
22 S B -0.8923
23 C B 0.0000
24 R B -2.8637
25 S B 0.0000
26 S B -1.9006
27 Q B -2.7581
28 E B -2.9025
29 T B 0.0000
30 S B -1.4779
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -1.1837
38 K B -1.8756
39 P B -1.1662
40 G B -1.5418
41 Q B -2.2052
42 S B -1.4652
43 P B 0.0000
44 Q B -1.2420
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.3749
49 G B -0.8410
50 T B 0.0000
51 S B -0.6276
52 T B -0.9280
53 R B -2.2476
54 A B 0.0000 mutated: GA54B
55 S B -0.9475
56 G B -1.0965
57 V B 0.0000
58 P B -1.5197
59 D B -2.4172
60 R B -2.1131
61 F B 0.0000
62 S B -1.3984
63 G B 0.0000
64 S B -0.7037
65 G B -1.1383
66 S B -1.2606
67 G B -1.8285
68 T B -2.3842
69 D B -2.5594
70 F B 0.0000
71 T B -1.0311
72 L B 0.0000
73 K B -1.4087
74 I B 0.0000
75 S B -2.2543
76 R B -3.0510
77 V B 0.0000
78 E B -2.3637
79 A B -1.3878
80 E B -2.1243
81 D B 0.0000
82 V B -0.9724
83 G B 0.0000
84 V B -0.3550
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B -0.3379
91 T B -1.1560
92 G B -0.7058
93 C B 0.4755
94 P B -0.1006
95 G B -0.0054
96 T B -0.4259
97 F B -0.2901
98 G B 0.0000
99 Q B -1.3326
100 G B 0.0000
101 T B 0.0000
102 K B -0.7648
103 L B 0.0000
104 E B -1.7000
105 I B -1.8821
106 K B -2.8043
107 R B -2.7816
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8317 2.2605 View CSV PDB
4.5 -0.8771 2.1924 View CSV PDB
5.0 -0.9322 2.1052 View CSV PDB
5.5 -0.988 2.0093 View CSV PDB
6.0 -1.035 1.9102 View CSV PDB
6.5 -1.0657 1.8102 View CSV PDB
7.0 -1.0786 1.71 View CSV PDB
7.5 -1.0786 1.6104 View CSV PDB
8.0 -1.071 1.5127 View CSV PDB
8.5 -1.0572 1.447 View CSV PDB
9.0 -1.0374 1.6043 View CSV PDB