Project name: fold_rfa148_mut8_b3a5b27 [mutate: LS11A]

Status: done

Started: 2026-06-26 09:14:12
Chain sequence(s) A: EVQLAESGGGLVQPGGSLRLSCAASGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSS
B: DIAMTQSPLSLPVTPGEPASISCRSSQETSAIGWYLQKPGQSPRLLIYGTSTRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTGVPGTFGQGTKLEIRR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues LS11A
Energy difference between WT (input) and mutated protein (by FoldX) 1.02831 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:56)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/5854462ec8c1f07/tmp/folded.pdb                (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:13)
Show buried residues

Minimal score value
-3.183
Maximal score value
1.5134
Average score
-0.8113
Total score value
-188.2282

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.9279
2 V A -0.8589
3 Q A -1.3178
4 L A 0.0000
5 A A -0.5650
6 E A 0.0000
7 S A -0.8679
8 G A -1.0583
9 G A -0.7790
10 G A -0.6188
11 S A -0.5859 mutated: LS11A
12 V A -0.8879
13 Q A -1.6949
14 P A -1.7773
15 G A -1.4479
16 G A -1.2072
17 S A -1.5102
18 L A -1.3427
19 R A -2.4113
20 L A 0.0000
21 S A -0.7758
22 C A 0.0000
23 A A -0.6634
24 A A 0.0000
25 S A -0.9453
26 G A -1.0667
27 F A -0.4317
28 T A -0.3358
29 F A 0.0000
30 S A -1.2271
31 S A -0.8403
32 Q A -0.9498
33 G A -0.8985
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8203
40 A A -1.2078
41 P A -0.9854
42 G A -1.4513
43 K A -2.3785
44 G A -1.5761
45 L A 0.0000
46 E A -1.1022
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.4714
51 I A 0.0000
52 S A -0.7650
53 A A -1.3134
54 D A -2.2156
55 G A -1.4528
56 S A -0.9091
57 G A -0.3959
58 T A 0.3475
59 Y A 0.9560
60 Y A -0.1552
61 A A 0.0000
62 D A -2.3979
63 S A -1.7776
64 V A 0.0000
65 K A -2.4796
66 G A -1.8541
67 R A -1.8123
68 F A 0.0000
69 T A -0.9753
70 I A 0.0000
71 S A -0.5865
72 R A -1.3838
73 D A -1.7747
74 D A -2.3114
75 S A -1.7887
76 K A -2.4994
77 N A -1.9349
78 T A 0.0000
79 L A 0.0000
80 Y A 0.0000
81 L A 0.0000
82 Q A -1.7988
83 M A 0.0000
84 N A -2.1575
85 S A -1.4533
86 L A 0.0000
87 R A -2.2619
88 A A -1.6875
89 E A -2.2198
90 D A 0.0000
91 T A -0.8341
92 A A 0.0000
93 V A 0.1595
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.3673
99 L A -0.4540
100 S A -0.9161
101 R A -2.5454
102 V A 0.0000
103 R A -2.7566
104 V A -0.9820
105 G A -1.0660
106 S A -1.0951
107 T A -1.7288
108 R A -2.8928
109 G A 0.0000
110 V A -1.0749
111 V A 0.0000
112 G A 0.0000
113 D A -0.5221
114 V A -0.2138
115 W A 0.0000
116 G A 0.0000
117 Q A -1.5934
118 G A -0.7560
119 T A -0.3974
120 T A -0.1545
121 V A 0.0000
122 T A -0.6977
123 V A 0.0000
124 S A -1.1011
125 S A -0.8929
1 D B -1.5115
2 I B -1.0059
3 A B -0.9980
4 M B 0.0000
5 T B -0.9616
6 Q B 0.0000
7 S B -0.2093
8 P B 0.2110
9 L B 0.9370
10 S B 0.0455
11 L B -0.2089
12 P B -1.1539
13 V B 0.0000
14 T B -1.5361
15 P B -1.6892
16 G B -1.7002
17 E B -1.8672
18 P B -1.9937
19 A B 0.0000
20 S B -0.9116
21 I B 0.0000
22 S B -0.9906
23 C B 0.0000
24 R B -2.8511
25 S B 0.0000
26 S B -1.8954
27 Q B -2.7401
28 E B -2.9054
29 T B 0.0000
30 S B -1.2991
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B -1.0817
38 K B -1.7688
39 P B -1.1158
40 G B -1.4911
41 Q B -2.0954
42 S B -1.3857
43 P B 0.0000
44 R B -0.9991
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.1377
49 G B -0.7191
50 T B 0.0000
51 S B -0.4254
52 T B -0.4838
53 R B -1.3058
54 A B -0.6859
55 S B -0.6654
56 G B -0.8654
57 V B -0.9465
58 P B -1.2583
59 D B -2.3782
60 R B -2.1926
61 F B 0.0000
62 S B -1.4472
63 G B 0.0000
64 S B -0.9374
65 G B -1.1498
66 S B -1.3231
67 G B -1.8022
68 T B -2.3670
69 D B -2.5373
70 F B 0.0000
71 T B -1.2364
72 L B 0.0000
73 K B -2.1907
74 I B 0.0000
75 S B -2.3517
76 R B -3.1830
77 V B 0.0000
78 E B -2.4706
79 A B -1.4504
80 E B -2.1833
81 D B 0.0000
82 V B -0.9602
83 G B 0.0000
84 V B -0.3918
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B -0.1637
91 T B -0.8535
92 G B -0.0046
93 V B 1.5134
94 P B 0.4288
95 G B 0.2875
96 T B -0.2738
97 F B -0.2707
98 G B 0.0000
99 Q B -1.3040
100 G B 0.0000
101 T B 0.0000
102 K B -0.8360
103 L B 0.0000
104 E B -1.4735
105 I B -1.4684
106 R B -2.1555
107 R B -2.4506
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8672 2.1293 View CSV PDB
4.5 -0.9151 2.0787 View CSV PDB
5.0 -0.9718 2.0053 View CSV PDB
5.5 -1.0289 1.9191 View CSV PDB
6.0 -1.0781 1.8279 View CSV PDB
6.5 -1.1122 1.7349 View CSV PDB
7.0 -1.1297 1.6415 View CSV PDB
7.5 -1.1351 1.5482 View CSV PDB
8.0 -1.1328 1.4558 View CSV PDB
8.5 -1.1235 1.4511 View CSV PDB
9.0 -1.1072 1.6081 View CSV PDB