Project name: 4W4N [mutate: HD268A, MQ252A]

Status: done

Started: 2026-03-17 10:25:33
Chain sequence(s) A: PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSSCSVMHEALHNHYTQKSSLSL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues HD268A,MQ252A
Energy difference between WT (input) and mutated protein (by FoldX) 0.843487 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:04)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:04)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:04)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:04)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:04)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:04)
[INFO]       FoldX:    Building mutant model                                                       (00:05:52)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:49)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/587dec87ba68d17/tmp/folded.pdb                (00:06:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:40)
Show buried residues

Minimal score value
-3.5074
Maximal score value
1.4572
Average score
-1.0012
Total score value
-206.2519

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
238 P A -0.8941
239 S A -0.1919
240 V A 0.0000
241 F A 1.1493
242 L A 0.8722
243 F A 1.0789
244 P A -0.1439
245 P A 0.0000
246 K A -2.0941
247 P A -1.5320
248 K A -1.4713
249 D A -1.1891
250 T A 0.0000
251 L A 0.0000
252 Q A -0.0663 mutated: MQ252A
253 I A 1.4572
254 S A 0.2116
255 R A -0.6245
256 T A -0.4372
257 P A 0.0000
258 E A -0.8090
259 V A 0.0000
260 T A 0.3292
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.8440
265 D A -2.2918
266 V A 0.0000
267 S A -2.8057
268 D A -3.5074 mutated: HD268A
269 E A -3.3632
270 D A -2.8677
271 P A -2.6935
272 E A -3.0613
273 V A -1.6971
274 K A -2.0315
275 F A -1.1109
276 N A -1.2304
277 W A 0.0000
278 Y A -0.6346
279 V A -0.8418
280 D A -1.7512
281 G A -0.6958
282 V A 0.6778
283 E A -0.3751
284 V A -0.5176
285 H A -1.6105
286 N A -2.0992
287 A A -1.7845
288 K A -2.2973
289 T A -1.7027
290 K A -2.2163
291 P A -2.2102
292 R A -3.1283
293 E A -3.1436
294 E A -3.2015
295 Q A -1.8971
296 Y A -0.0255
297 N A -1.2466
298 S A -1.6473
299 T A -2.0893
300 Y A -2.5234
301 R A -2.4700
302 V A 0.0000
303 V A -0.7769
304 S A 0.0000
305 V A -0.7770
306 L A 0.0000
307 T A -0.5300
308 V A 0.0000
309 L A 0.9354
310 H A -0.0754
311 Q A -1.1173
312 D A -1.3580
313 W A 0.0000
314 L A -1.2619
315 N A -2.2464
316 G A -2.3800
317 K A -2.4150
318 E A -2.7002
319 Y A 0.0000
320 K A -1.7648
321 C A 0.0000
322 K A -1.6052
323 V A 0.0000
324 S A -1.4601
325 N A 0.0000
326 K A -2.3804
327 A A -1.3417
328 L A -0.4821
329 P A -0.4278
330 A A -0.4265
331 P A -0.9984
332 I A -0.7746
333 E A -1.9574
334 K A -1.3671
335 T A -1.1892
336 I A -0.5241
337 S A -1.4236
338 K A -1.5065
339 A A -1.2188
340 K A -2.3745
341 G A -2.0679
342 Q A -2.2779
343 P A -2.0292
344 R A -2.7231
345 E A -3.0926
346 P A 0.0000
347 Q A -1.6696
348 V A 0.0000
349 Y A 0.2596
350 T A 0.3451
351 L A 0.6094
352 P A 0.0769
353 P A -0.8188
354 S A -1.7084
355 R A -2.8798
356 D A -3.1071
357 E A -2.6353
358 L A -2.2918
359 T A -2.1005
360 K A -3.0540
361 N A -2.8725
362 Q A -2.5659
363 V A 0.0000
364 S A -0.9349
365 L A 0.0000
366 T A -0.0738
367 C A 0.0000
368 L A 0.3274
369 V A 0.0000
370 K A -0.9619
371 G A -1.5804
372 F A 0.0000
373 Y A -1.3200
374 P A 0.0000
375 S A -0.1033
376 D A -1.2560
377 I A 0.0000
378 A A -0.6617
379 V A 0.0000
380 E A -1.4502
381 W A 0.0000
382 E A -1.6245
383 S A 0.0000
384 N A -1.8588
385 G A -1.7172
386 Q A -2.2225
387 P A -1.9169
388 E A 0.0000
389 N A -2.4427
390 N A -2.3840
391 Y A -2.2534
392 K A -2.5798
393 T A -1.2064
394 T A -0.4368
395 P A -0.0176
396 P A 0.5333
397 V A 1.4135
398 L A 1.2324
399 D A -0.5528
400 S A -1.0841
401 D A -2.0149
402 G A -0.8523
403 S A 0.0000
404 F A 0.2400
405 F A 0.5244
406 L A 0.0000
407 Y A 0.1849
408 S A 0.0000
409 K A -2.0134
410 L A 0.0000
411 T A -1.5458
412 V A 0.0000
413 D A -2.3913
414 K A -2.6580
415 S A -2.1369
416 R A -1.8278
417 W A 0.0000
418 Q A -1.9567
419 Q A -1.9331
420 G A -0.8366
421 N A -0.7431
422 V A 0.3562
423 F A 0.0000
424 S A -1.0616
425 C A 0.0000
426 S A 0.0000
427 V A 0.0000
428 M A 0.0000
429 H A 0.0000
430 E A -1.2579
431 A A -1.6789
432 L A -1.5510
433 H A -1.7605
434 N A -1.7376
435 H A -1.2447
436 Y A -0.5079
437 T A -0.9482
438 Q A -1.4152
439 K A -1.4124
440 S A -0.5650
441 L A 0.0000
442 S A 0.5019
443 L A 0.9446
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.777 3.3398 View CSV PDB
4.5 -0.8558 3.326 View CSV PDB
5.0 -0.9493 3.3149 View CSV PDB
5.5 -1.0389 3.3195 View CSV PDB
6.0 -1.1046 3.3494 View CSV PDB
6.5 -1.1309 3.4051 View CSV PDB
7.0 -1.1182 3.4797 View CSV PDB
7.5 -1.0807 3.5643 View CSV PDB
8.0 -1.0304 3.6526 View CSV PDB
8.5 -0.9711 3.7416 View CSV PDB
9.0 -0.9022 3.8286 View CSV PDB