Project name: VAAV_R1

Status: done

Started: 2026-08-21 03:16:56
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/58f2fe485d1463e/tmp/folded.pdb                (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:57)
Show buried residues

Minimal score value
-2.5359
Maximal score value
2.0792
Average score
-0.543
Total score value
-134.6599

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5675
2 V A -1.2366
3 Q A -1.9277
4 L A 0.0000
5 Q A -1.8387
6 E A 0.0000
7 S A -0.7066
8 G A -0.4663
9 P A -0.1117
10 G A 0.1775
11 L A 0.6070
12 V A 0.0000
13 K A -1.6601
14 P A -1.2976
15 S A -1.4165
16 Q A -1.9863
17 T A -1.6482
18 L A 0.0000
19 S A -0.9291
20 L A 0.0000
21 T A -0.5669
22 V A 0.0000
23 T A -1.2118
24 V A 0.0000
25 S A -1.2281
26 G A -1.2809
27 G A -0.9886
28 S A -0.6668
29 I A 0.0000
30 S A -0.2578
31 S A -0.2908
32 G A -0.0409
33 D A 0.0443
34 Y A 0.6054
35 Y A 0.6018
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.3847
41 Q A 0.0000
42 P A -0.7311
43 P A -0.6775
44 G A -1.1161
45 C A -1.2658
46 K A -2.0534
47 G A -1.2063
48 L A 0.0000
49 E A -0.7847
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1643
54 I A 0.0000
55 Y A 0.4112
56 Y A 0.3396
57 S A -0.0817
58 G A -0.2177
59 S A -0.2469
60 T A -0.2400
61 D A -0.7259
62 Y A -0.7426
63 N A -0.9881
64 P A -1.1711
65 S A -1.0153
66 L A 0.0000
67 K A -2.1341
68 S A -1.5025
69 R A -1.7387
70 V A 0.0000
71 T A -1.0190
72 M A 0.0000
73 S A -0.2253
74 V A -0.3300
75 D A -1.1779
76 T A -1.0403
77 S A -1.3325
78 K A -2.1782
79 N A -1.4395
80 Q A -1.2497
81 F A 0.0000
82 S A -0.4058
83 L A 0.0000
84 K A -1.2490
85 V A 0.0000
86 N A -2.0283
87 S A -1.5835
88 V A 0.0000
89 T A -0.6727
90 A A -0.2116
91 A A -0.0270
92 D A 0.0000
93 T A 0.2266
94 A A 0.0000
95 V A 0.1926
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7261
103 I A 1.4874
104 F A 2.0792
105 G A 0.9649
106 V A 0.7072
107 G A 0.5714
108 T A 0.0000
109 F A 0.0000
110 D A -0.6361
111 Y A -0.5879
112 W A -0.8172
113 G A 0.0000
114 Q A -1.6406
115 G A -0.7689
116 T A -0.1929
117 L A 0.7806
118 V A 0.0000
119 T A 0.2441
120 V A 0.0000
121 S A -0.3582
122 S A -0.6421
123 A A -0.5911
124 A A -0.3537
125 G A -0.8398
126 G A -1.0799
127 G A -1.1422
128 G A -1.1732
129 S A -1.0281
130 G A -1.1508
131 G A -1.2241
132 G A -1.1887
133 G A -1.2035
134 S A -1.0322
135 G A -1.1817
136 G A -1.3436
137 G A -1.2583
138 G A -1.2839
139 S A -1.0467
140 D A -1.2125
141 I A -0.2691
142 V A 0.9067
143 M A 0.0000
144 T A -0.5993
145 Q A -0.6963
146 S A -0.7494
147 P A -0.3514
148 A A -0.3411
149 T A -0.4364
150 L A -0.1675
151 S A -0.2876
152 L A -0.5290
153 S A -0.8317
154 P A -1.3521
155 G A -1.6573
156 E A -2.1031
157 R A -2.5359
158 A A 0.0000
159 T A -0.6337
160 L A 0.0000
161 S A -0.8880
162 A A 0.0000
163 R A -2.3481
164 A A 0.0000
165 S A -0.9092
166 Q A -1.6145
167 S A -1.2109
168 V A 0.0000
169 S A -0.4573
170 S A -0.2106
171 Y A 0.7727
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.5006
179 P A -0.9301
180 G A -1.0051
181 C A -1.1404
182 Q A -1.6287
183 A A -1.1973
184 P A 0.0000
185 R A -1.5178
186 L A -0.7054
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4512
190 D A -0.6075
191 A A 0.0000
192 S A -1.1696
193 N A -1.7452
194 R A -1.6557
195 A A -1.0685
196 T A -0.6408
197 G A -0.6564
198 I A 0.0000
199 P A -0.4265
200 A A -0.3586
201 R A -0.6764
202 F A 0.0000
203 S A -0.7541
204 G A -0.8276
205 S A -0.8830
206 G A -1.1407
207 S A -0.9536
208 G A -1.0537
209 T A -1.7611
210 D A -2.1792
211 F A 0.0000
212 T A -0.7870
213 L A 0.0000
214 T A -0.5916
215 I A 0.0000
216 S A -1.2750
217 S A -1.6176
218 L A 0.0000
219 E A -2.1120
220 P A -1.3724
221 E A -2.1028
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.3934
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A 0.0408
233 S A -0.2856
234 T A -0.4660
235 P A -0.5198
236 L A 0.0000
237 T A 0.1018
238 F A 0.2637
239 G A 0.0000
240 G A -0.7780
241 G A -0.7271
242 T A 0.0000
243 K A -0.9839
244 A A 0.0000
245 E A -0.3790
246 I A 0.8862
247 K A -0.6354
248 A A -0.2242
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4742 4.7736 View CSV PDB
4.5 -0.4941 4.7718 View CSV PDB
5.0 -0.5171 4.7667 View CSV PDB
5.5 -0.5379 4.7541 View CSV PDB
6.0 -0.551 4.7297 View CSV PDB
6.5 -0.5522 4.695 View CSV PDB
7.0 -0.5425 4.6546 View CSV PDB
7.5 -0.5257 4.6119 View CSV PDB
8.0 -0.505 4.5686 View CSV PDB
8.5 -0.4813 4.525 View CSV PDB
9.0 -0.4546 4.4815 View CSV PDB