Project name: VAAV_R2

Status: done

Started: 2026-08-21 03:17:27
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:38)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/58fbcb4f1c44e61/tmp/folded.pdb                (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:55)
Show buried residues

Minimal score value
-2.5675
Maximal score value
1.9842
Average score
-0.5317
Total score value
-131.868

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5691
2 V A -1.2339
3 Q A -1.9307
4 L A 0.0000
5 Q A -1.8392
6 E A 0.0000
7 S A -0.7039
8 G A -0.4082
9 P A 0.0253
10 G A 0.3815
11 L A 0.9695
12 V A 0.0000
13 K A -1.8409
14 P A -1.3432
15 S A -1.4307
16 Q A -1.9900
17 T A -1.6333
18 L A 0.0000
19 S A -1.0033
20 L A 0.0000
21 T A -0.6336
22 V A 0.0000
23 T A -1.2254
24 V A 0.0000
25 S A -1.2356
26 G A -1.2838
27 G A -0.9919
28 S A -0.6233
29 I A 0.0000
30 S A -0.3055
31 S A -0.3556
32 G A -0.1258
33 D A -0.0078
34 Y A 0.5992
35 Y A 0.5577
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6797
43 P A -0.6459
44 G A -1.1088
45 C A -1.1976
46 K A -2.0059
47 G A -1.1959
48 L A 0.0000
49 E A -0.7377
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A -0.0175
54 I A 0.0000
55 Y A 0.2416
56 Y A 0.2711
57 S A -0.1069
58 G A -0.2054
59 S A -0.3453
60 T A -0.4567
61 D A -1.1385
62 Y A -0.8732
63 N A -0.9778
64 P A -1.1191
65 S A -0.9998
66 L A 0.0000
67 K A -2.1412
68 S A -1.4100
69 R A -1.6621
70 V A 0.0000
71 T A -1.1679
72 M A 0.0000
73 S A -0.4077
74 V A -0.4061
75 D A -1.2834
76 T A -1.0924
77 S A -1.3710
78 K A -2.1978
79 N A -1.4575
80 Q A -1.2857
81 F A 0.0000
82 S A -0.5661
83 L A 0.0000
84 K A -1.6393
85 V A 0.0000
86 N A -1.7653
87 S A -1.5359
88 V A 0.0000
89 T A -0.6877
90 A A -0.3087
91 A A -0.1497
92 D A 0.0000
93 T A 0.3013
94 A A 0.0000
95 V A 0.2583
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.7690
103 I A 1.5375
104 F A 1.9842
105 G A 0.7897
106 V A 0.8389
107 G A 0.6402
108 T A 0.0000
109 F A 0.0000
110 D A -0.5155
111 Y A -0.5216
112 W A -0.7855
113 G A 0.0000
114 Q A -1.6358
115 G A -0.7399
116 T A -0.1645
117 L A 0.8847
118 V A 0.0000
119 T A 0.3632
120 V A 0.0000
121 S A -0.3808
122 S A -0.6430
123 A A -0.6596
124 A A -0.3595
125 G A -0.8383
126 G A -1.0706
127 G A -1.1269
128 G A -1.1784
129 S A -1.0364
130 G A -1.1693
131 G A -1.2143
132 G A -1.1813
133 G A -1.2567
134 S A -1.0457
135 G A -1.2546
136 G A -1.1186
137 G A -1.2568
138 G A -1.2341
139 S A -0.8576
140 D A -0.8372
141 I A -0.0648
142 V A 0.9807
143 M A 0.0000
144 T A -0.5815
145 Q A -0.6509
146 S A -0.7052
147 P A -0.3380
148 A A -0.3325
149 T A -0.4320
150 L A -0.1721
151 S A -0.3060
152 L A -0.5533
153 S A -0.8704
154 P A -1.4157
155 G A -1.6964
156 E A -2.1507
157 R A -2.5675
158 A A 0.0000
159 T A -0.6383
160 L A 0.0000
161 S A -0.8750
162 A A 0.0000
163 R A -2.3485
164 A A 0.0000
165 S A -0.8614
166 Q A -1.5656
167 S A -1.2206
168 V A 0.0000
169 S A -0.4146
170 S A -0.1110
171 Y A 0.8399
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4922
179 P A -0.9433
180 G A -1.0128
181 C A -1.1465
182 Q A -1.6492
183 A A -1.2044
184 P A 0.0000
185 R A -1.4811
186 L A -0.7069
187 L A 0.0000
188 I A 0.0000
189 Y A -0.1878
190 D A -0.2990
191 A A 0.0000
192 S A -0.8587
193 N A -1.2695
194 R A -1.4117
195 A A -0.9429
196 T A -0.6507
197 G A -0.6431
198 I A 0.0000
199 P A -0.4453
200 A A -0.3843
201 R A -0.7306
202 F A 0.0000
203 S A -0.6765
204 G A 0.0000
205 S A -0.7769
206 G A -1.1133
207 S A -0.9286
208 G A -1.0578
209 T A -1.7682
210 D A -2.1954
211 F A 0.0000
212 T A -0.7778
213 L A 0.0000
214 T A -0.5932
215 I A 0.0000
216 S A -1.3066
217 S A -1.6590
218 L A 0.0000
219 E A -2.2890
220 P A -1.5202
221 E A -2.3506
222 D A 0.0000
223 F A 0.0000
224 A A 0.0000
225 V A -0.5647
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3210
232 G A 0.0596
233 S A -0.2018
234 T A -0.4639
235 P A -0.4610
236 L A 0.0000
237 T A 0.1991
238 F A 0.2733
239 G A 0.0000
240 G A -0.7738
241 G A -0.7195
242 T A 0.0000
243 K A -0.7362
244 A A 0.0000
245 E A -0.3700
246 I A 0.7872
247 K A -0.7029
248 A A -0.2584
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4925 4.8961 View CSV PDB
4.5 -0.5137 4.8573 View CSV PDB
5.0 -0.538 4.8104 View CSV PDB
5.5 -0.5594 4.7601 View CSV PDB
6.0 -0.5719 4.7087 View CSV PDB
6.5 -0.5715 4.6569 View CSV PDB
7.0 -0.5593 4.6052 View CSV PDB
7.5 -0.5393 4.5539 View CSV PDB
8.0 -0.5149 4.504 View CSV PDB
8.5 -0.4871 4.4583 View CSV PDB
9.0 -0.4562 4.4217 View CSV PDB