Project name: 59a449006165df7

Status: done

Started: 2026-05-19 03:21:02
Chain sequence(s) A: SQQVEQSPQSLTVPEGENATLNCSYKTSINNLQWYRQDPGRGLVFLILIRSNEREKHSGRLTVTLDTSKKSSSLLITNARPADTALYFCATMGDSGYSTLTFGKGTMLTVTPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPKSVTLPEGESMTLQCSQDMNHEYMLWYRQDPGKGLRLIHYSVGAGITDQGEVPEGYNVSRSTTEDFPLRLLSAQPSDTSVYFCASSPMGGSYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:09)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/59a449006165df7/tmp/folded.pdb                (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:02)
Show buried residues

Minimal score value
-3.8801
Maximal score value
1.749
Average score
-0.8997
Total score value
-224.029

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -0.7349
2 Q A -1.3375
3 Q A -1.4950
4 V A 0.0000
5 E A -2.0660
6 Q A 0.0000
7 S A -1.2148
8 P A -1.0042
9 Q A -1.3943
10 S A -0.5127
11 L A -0.0722
12 T A -0.1088
13 V A 0.0000
14 P A -2.1173
15 E A -3.2118
16 G A -3.0300
17 E A -3.4085
18 N A -2.8569
19 A A 0.0000
20 T A -0.3923
21 L A 0.0000
22 N A -1.1992
23 C A 0.0000
24 S A -1.7422
25 Y A 0.0000
26 K A -2.5139
27 T A -1.3923
28 S A -1.2836
29 I A 0.0000
30 N A -1.9682
31 N A 0.0000
32 L A 0.0000
33 Q A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 R A 0.2113
37 Q A -0.3917
38 D A -0.8917
39 P A -1.1790
40 G A -1.7472
41 R A -2.0866
42 G A -0.5694
43 L A 0.0000
44 V A 1.7490
45 F A 1.4260
46 L A 0.8432
47 I A 0.0000
48 L A -0.3093
49 I A 0.0000
50 R A -2.6080
51 S A -2.1580
52 N A -2.7075
53 E A -3.1489
54 R A -3.8375
55 E A -3.8801
56 K A -2.8297
57 H A -1.9519
58 S A -1.0063
59 G A -0.9139
60 R A -1.0970
61 L A -0.6364
62 T A -1.0663
63 V A 0.0000
64 T A -2.0342
65 L A 0.0000
66 D A -2.6862
67 T A -2.1263
68 S A -1.5956
69 K A -2.6788
70 K A -2.3936
71 S A -1.8442
72 S A 0.0000
73 S A -0.6665
74 L A 0.0000
75 L A -0.3584
76 I A 0.0000
77 T A -1.8116
78 N A -3.0560
79 A A 0.0000
80 R A -2.9478
81 P A -1.3424
82 A A -0.7320
83 D A 0.0000
84 T A -0.3447
85 A A 0.0000
86 L A -0.0310
87 Y A 0.0000
88 F A 0.0000
89 C A 0.0000
90 A A 0.0000
91 T A 0.0000
92 M A 0.0000
93 G A -1.3556
94 D A -2.2561
95 S A -1.2139
96 G A -0.7524
97 Y A 0.1834
98 S A 0.0000
99 T A 0.0535
100 L A 0.0000
101 T A -0.3787
102 F A 0.0000
103 G A 0.0000
104 K A -1.4525
105 G A 0.0000
106 T A 0.0000
107 M A -0.0197
108 L A 0.0000
109 T A -0.3193
110 V A 0.0000
111 T A -1.2146
112 P A -1.4426
113 G A -1.8241
114 G A -1.4242
115 G A -1.5496
116 S A -1.6794
117 E A -2.5156
118 G A -1.8102
119 G A -1.4683
120 G A -1.4815
121 S A -1.5290
122 E A -2.3602
123 G A -1.7912
124 G A -1.3458
125 G A -1.4100
126 S A -1.6302
127 E A -2.4707
128 G A -1.8779
129 G A -1.8234
130 G A -1.8426
131 S A -1.7314
132 E A -2.5236
133 G A -1.8002
134 G A -1.6618
135 T A -1.2240
136 G A -1.3510
137 N A -1.8707
138 A A -0.9415
139 G A -0.9836
140 V A 0.0000
141 T A -0.8536
142 Q A 0.0000
143 T A -1.0468
144 P A -1.2925
145 K A -2.1822
146 S A -1.4994
147 V A -0.5191
148 T A -0.3209
149 L A -0.8467
150 P A -1.6650
151 E A -2.8836
152 G A -2.2231
153 E A -2.2590
154 S A -1.4304
155 M A 0.0000
156 T A -0.8846
157 L A 0.0000
158 Q A -0.9245
159 C A 0.0000
160 S A -1.1539
161 Q A 0.0000
162 D A -2.6279
163 M A -1.4419
164 N A -2.0692
165 H A -1.2041
166 E A -0.9517
167 Y A 0.0000
168 M A 0.0000
169 L A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A -0.5082
173 Q A -0.8680
174 D A -0.9373
175 P A -0.9120
176 G A -1.2251
177 K A -1.5755
178 G A 0.0000
179 L A 0.0000
180 R A -0.7444
181 L A 0.0000
182 I A 0.0000
183 H A -1.5294
184 Y A 0.0000
185 S A 0.0000
186 V A 0.4913
187 G A 0.2296
188 A A -0.0615
189 G A 0.3718
190 I A 1.4094
191 T A -0.2022
192 D A -1.4956
193 Q A -2.4661
194 G A -1.7057
195 E A -1.6344
196 V A -1.0357
197 P A -1.8912
198 E A -2.3369
199 G A -1.6833
200 Y A 0.0000
201 N A -2.0715
202 V A -1.2061
203 S A -0.5122
204 R A 0.0000
205 S A -0.4085
206 T A -0.8465
207 T A -1.4949
208 E A -2.2081
209 D A -1.5407
210 F A 0.0000
211 P A -0.9585
212 L A 0.0000
213 R A -1.8365
214 L A 0.0000
215 L A -0.9279
216 S A -1.4503
217 A A 0.0000
218 Q A -1.9079
219 P A -1.2008
220 S A -0.8684
221 D A -0.8498
222 T A -0.6866
223 S A 0.0000
224 V A -0.7251
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 P A -0.0353
232 M A 0.5405
233 G A 0.0518
234 G A -0.3620
235 S A -0.3660
236 Y A 0.1591
237 E A 0.3585
238 Q A 0.0000
239 Y A 1.2556
240 F A 0.7215
241 G A 0.0000
242 P A -0.9752
243 G A 0.0000
244 T A 0.0000
245 R A -2.1587
246 L A 0.0000
247 T A -0.6487
248 V A -0.9265
249 T A -0.7698
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6412 2.7209 View CSV PDB
4.5 -0.6953 2.6751 View CSV PDB
5.0 -0.763 2.6152 View CSV PDB
5.5 -0.833 2.5487 View CSV PDB
6.0 -0.8938 2.4797 View CSV PDB
6.5 -0.9356 2.41 View CSV PDB
7.0 -0.9549 2.3401 View CSV PDB
7.5 -0.9572 2.2705 View CSV PDB
8.0 -0.9496 2.2022 View CSV PDB
8.5 -0.9352 2.1376 View CSV PDB
9.0 -0.9149 2.0824 View CSV PDB