Project name: Human PrP Q160X

Status: done

Started: 2026-03-26 19:03:34
Chain sequence(s) A: GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:01:23)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:15:27)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:15:28)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:15:28)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:15:29)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:15:29)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:15:29)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:15:30)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:15:30)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:15:31)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:15:31)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:15:31)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:15:32)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:15:32)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:15:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:15:36)
Show buried residues

Minimal score value
-3.5639
Maximal score value
2.882
Average score
-0.5892
Total score value
-81.894

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 G A -1.1954
2 S A -1.4012
3 K A -2.1592
4 K A -2.7443
5 R A -1.8371
6 P A -0.9787
7 K A 0.0000
8 P A -0.0277
9 G A 0.0000
10 G A -0.0181
11 W A 0.3354
12 N A -0.8569
13 T A -0.6577
14 G A -0.8258
15 G A -0.6662
16 S A -0.3617
17 R A 0.0000
18 Y A 0.7281
19 P A 0.1097
20 G A -0.6868
21 Q A -0.9874
22 G A 0.0000
23 S A 0.0000
24 P A 0.0000
25 G A -1.4035
26 G A -1.4867
27 N A -2.1281
28 R A -1.5263
29 Y A -0.0238
30 P A -0.2534
31 P A -0.7348
32 Q A -1.3561
33 G A -1.2925
34 G A -1.1864
35 G A -1.1439
36 G A 0.0000
37 W A 0.0000
38 G A 0.0000
39 Q A -0.5900
40 P A -0.7795
41 H A 0.0000
42 G A -0.9693
43 G A -1.0494
44 G A -1.0787
45 W A -0.5137
46 G A -0.7407
47 Q A 0.0000
48 P A -0.7059
49 H A -1.2976
50 G A 0.0000
51 G A -1.4653
52 G A -1.2399
53 W A -0.7348
54 G A -0.5775
55 Q A -0.6851
56 P A -0.7655
57 H A -1.3495
58 G A -1.2135
59 G A 0.0000
60 G A 0.0000
61 W A -0.2646
62 G A 0.0000
63 Q A -1.3818
64 P A -1.3394
65 H A -1.6404
66 G A -1.3087
67 G A -0.9089
68 G A -0.5285
69 W A 0.0224
70 G A -0.8934
71 Q A -1.6520
72 G A -1.5474
73 G A -1.5258
74 G A -1.6216
75 T A -1.6249
76 H A -1.8162
77 S A -1.8935
78 Q A -2.0614
79 W A -1.1155
80 N A -2.4589
81 K A -3.2298
82 P A -2.3471
83 S A -2.5126
84 K A -3.5639
85 P A -2.8292
86 K A -3.2996
87 T A -2.3620
88 N A -1.9916
89 M A -0.8902
90 K A -2.3099
91 H A -1.9381
92 M A -0.3886
93 A A -0.5290
94 G A -0.8992
95 A A -0.3914
96 A A 0.3986
97 A A 0.6822
98 A A 0.7874
99 G A 1.1480
100 A A 1.4500
101 V A 2.4880
102 V A 2.4660
103 G A 1.1596
104 G A 1.6311
105 L A 2.1583
106 G A 1.1290
107 G A 1.4678
108 Y A 2.4130
109 M A 2.6425
110 L A 2.4582
111 G A 1.3780
112 S A 0.8877
113 A A 1.2879
114 M A 1.3198
115 S A 0.6966
116 R A 0.4579
117 P A 1.1225
118 I A 2.8820
119 I A 2.6632
120 H A 1.3395
121 F A 1.9500
122 G A 0.4954
123 S A -0.0887
124 D A -0.9257
125 Y A -0.4002
126 E A -1.9503
127 D A -2.3301
128 R A -2.5729
129 Y A -0.9355
130 Y A -0.9528
131 R A -2.4800
132 E A -2.2403
133 N A -1.6124
134 M A -1.0994
135 H A -1.9288
136 R A -2.4434
137 Y A -0.6356
138 P A -0.9689
139 N A -1.7241
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5892 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_6 -0.5892 View CSV PDB
model_2 -0.6264 View CSV PDB
model_9 -0.6341 View CSV PDB
model_0 -0.6429 View CSV PDB
model_1 -0.65 View CSV PDB
model_3 -0.6678 View CSV PDB
model_7 -0.6972 View CSV PDB
CABS_average -0.7723 View CSV PDB
model_5 -0.8108 View CSV PDB
model_11 -0.9505 View CSV PDB
model_4 -0.9736 View CSV PDB
input -0.9767 View CSV PDB
model_10 -1.0104 View CSV PDB
model_8 -1.0146 View CSV PDB