Project name: 17 ANTIBODY

Status: done

Started: 2026-06-05 11:01:34
Chain sequence(s) A: DIVMTQSPLSLPVTPGEPASISCRSSQSLLNGYNQKNYLTWYLQKPGQSPQLLIYWASTRETGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNDYSYPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFNSYYINWVRQAPGQGLEWMGNIYPSDSYTNYNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWRGNSFDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/5a5bb3c6db84d4f/tmp/folded.pdb                (00:03:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:35)
Show buried residues

Minimal score value
-3.5641
Maximal score value
0.9903
Average score
-0.7134
Total score value
-175.4892

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.3850
2 I A -0.1545
3 V A 0.7280
4 M A 0.0000
5 T A -0.5418
6 Q A 0.0000
7 S A -0.2855
8 P A 0.0932
9 L A 0.6629
10 S A -0.0243
11 L A -0.2938
12 P A -1.0923
13 V A 0.0000
14 T A -1.6071
15 P A -1.6738
16 G A -1.7848
17 E A -2.1932
18 P A -2.1507
19 A A 0.0000
20 S A -0.8806
21 I A 0.0000
22 S A -1.0122
23 C A 0.0000
24 R A -2.2835
25 S A 0.0000
26 S A -0.9476
27 Q A -1.4637
28 S A -0.9513
29 L A 0.0000
30 L A -0.2618
31 N A -0.5011
32 G A -0.5116
33 Y A 0.4011
34 N A -0.7035
35 Q A -1.4918
36 K A -1.2218
37 N A 0.0000
38 Y A -0.0630
39 L A 0.0000
40 T A 0.0000
41 W A 0.0000
42 Y A 0.0000
43 L A 0.0000
44 Q A 0.0000
45 K A -1.6792
46 P A -1.1992
47 G A -1.5300
48 Q A -2.0717
49 S A -1.2636
50 P A 0.0000
51 Q A -1.0136
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A 0.0000
56 W A -0.4641
57 A A 0.0000
58 S A -0.6837
59 T A -0.6103
60 R A -1.4264
61 E A -1.1064
62 T A -0.6142
63 G A -0.9572
64 V A -1.0229
65 P A -1.3807
66 D A -2.3099
67 R A -2.2825
68 F A 0.0000
69 S A -1.5246
70 G A 0.0000
71 S A -0.9309
72 G A -1.1336
73 S A -1.1382
74 G A -1.0764
75 T A -1.7196
76 D A -2.4496
77 F A 0.0000
78 T A -1.2544
79 L A 0.0000
80 K A -2.1488
81 I A 0.0000
82 S A -2.4135
83 R A -3.0643
84 V A 0.0000
85 E A -2.2228
86 A A -1.6043
87 E A -2.3921
88 D A 0.0000
89 V A -1.0186
90 G A 0.0000
91 V A -0.2210
92 Y A 0.0000
93 Y A 0.0000
94 C A 0.0000
95 Q A 0.0000
96 N A 0.0000
97 D A 0.0000
98 Y A 0.6782
99 S A 0.4350
100 Y A 0.5670
101 P A -0.2217
102 F A 0.0000
103 T A 0.1797
104 F A 0.1061
105 G A 0.0000
106 Q A -1.0863
107 G A 0.0000
108 T A 0.0000
109 K A -0.6590
110 L A 0.0000
111 E A -1.6342
112 I A -1.5195
113 K A -2.3418
114 G A -1.7461
115 G A -1.6364
116 G A -1.4319
117 G A -1.4414
118 S A -1.0741
119 G A -1.5999
120 G A -1.5721
121 G A -1.8125
122 G A -1.6583
123 S A -1.2555
124 G A -1.2327
125 G A -1.2329
126 G A -1.3690
127 G A -1.3941
128 S A -1.3151
129 Q A -1.7073
130 V A -1.0773
131 Q A -1.6606
132 L A 0.0000
133 V A -0.6216
134 Q A 0.0000
135 S A -0.6690
136 G A -0.5474
137 A A 0.2661
138 E A 0.0685
139 V A 0.9903
140 K A -0.9749
141 K A -2.1930
142 P A -2.2940
143 G A -1.6140
144 A A -1.2621
145 S A -1.3248
146 V A 0.0000
147 K A -1.7781
148 V A 0.0000
149 S A -0.7398
150 C A 0.0000
151 K A -1.4400
152 A A 0.0000
153 S A -0.9351
154 G A -0.8372
155 Y A -0.3835
156 T A -0.2650
157 F A 0.0000
158 N A -1.1793
159 S A -0.2735
160 Y A 0.1411
161 Y A 0.6002
162 I A 0.0000
163 N A 0.0000
164 W A 0.0000
165 V A 0.0000
166 R A -0.3280
167 Q A -0.5838
168 A A -0.9497
169 P A -0.9442
170 G A -1.2164
171 Q A -1.8681
172 G A -1.3022
173 L A 0.0000
174 E A -0.7338
175 W A 0.0000
176 M A 0.0000
177 G A 0.0000
178 N A 0.0000
179 I A 0.0000
180 Y A 0.1278
181 P A 0.0000
182 S A -1.1120
183 D A -1.6230
184 S A -0.5438
185 Y A 0.7672
186 T A 0.4750
187 N A 0.0637
188 Y A -1.0979
189 N A -1.8509
190 Q A -3.0468
191 K A -3.0845
192 F A 0.0000
193 K A -3.5641
194 D A -3.3061
195 R A -2.3400
196 V A 0.0000
197 T A -1.0856
198 M A 0.0000
199 T A -0.2600
200 R A -1.1844
201 D A -1.0445
202 T A -0.7778
203 S A -0.5173
204 T A -0.6932
205 S A -0.9184
206 T A 0.0000
207 V A 0.0000
208 Y A -0.7053
209 M A 0.0000
210 E A -1.4029
211 L A 0.0000
212 S A -1.3325
213 S A -1.4082
214 L A 0.0000
215 R A -3.1455
216 S A -2.4224
217 E A -2.5883
218 D A 0.0000
219 T A -0.7815
220 A A 0.0000
221 V A 0.4950
222 Y A 0.0000
223 Y A 0.0000
224 C A 0.0000
225 A A 0.0000
226 R A 0.0000
227 S A 0.0000
228 W A -0.3400
229 R A -1.2654
230 G A -0.7265
231 N A -0.5761
232 S A 0.0000
233 F A 0.0000
234 D A -0.3566
235 Y A -0.1514
236 W A -0.4399
237 G A 0.0000
238 Q A -1.3767
239 G A -0.4915
240 T A 0.0000
241 L A 0.8818
242 V A 0.0000
243 T A -0.1322
244 V A 0.0000
245 S A -1.1357
246 S A -1.0414
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6747 1.6578 View CSV PDB
4.5 -0.7143 1.6394 View CSV PDB
5.0 -0.7597 1.6091 View CSV PDB
5.5 -0.8031 1.5711 View CSV PDB
6.0 -0.8356 1.5318 View CSV PDB
6.5 -0.8501 1.4972 View CSV PDB
7.0 -0.8464 1.4731 View CSV PDB
7.5 -0.8297 1.4607 View CSV PDB
8.0 -0.8049 1.4558 View CSV PDB
8.5 -0.7734 1.5268 View CSV PDB
9.0 -0.7359 1.6042 View CSV PDB