Project name: ok 14

Status: done

Started: 2026-03-17 06:59:10
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASSSVSYMNWYKQKPGLAPRLLIYDTSNLAYGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSNNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:00)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:06)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/5b01cb4a79b3fe5/tmp/folded.pdb                (00:04:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:28)
Show buried residues

Minimal score value
-3.597
Maximal score value
1.1753
Average score
-0.7031
Total score value
-168.0477

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8389
2 I A 0.0000
3 V A 1.0353
4 L A 0.0000
5 T A -0.3246
6 K A -0.6003
7 S A -0.5519
8 P A -0.4231
9 A A -0.5473
10 T A -0.6473
11 L A -0.5479
12 S A -1.0560
13 L A -1.2022
14 S A -1.6581
15 P A -1.9851
16 G A -2.3709
17 E A -2.8737
18 R A -3.2344
19 A A 0.0000
20 T A -0.5603
21 L A 0.0000
22 S A -0.7297
23 C A 0.0000
24 S A -0.8227
25 A A 0.0000
26 S A -0.2489
27 S A -0.6164
28 S A -0.8680
29 V A 0.0000
30 S A -0.6223
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.3961
37 Q A 0.0000
38 K A -0.6519
39 P A -0.3085
40 G A -0.1348
41 L A 0.5043
42 A A -0.0254
43 P A 0.0000
44 R A -0.4345
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.1530
49 D A -0.9838
50 T A -0.7578
51 S A -0.6803
52 N A -0.3831
53 L A 0.1380
54 A A 0.0000
55 Y A 1.1753
56 G A -0.0702
57 I A -0.0222
58 P A -0.7791
59 D A -1.8925
60 R A -1.8994
61 F A 0.0000
62 S A -0.7091
63 G A -0.4973
64 S A -0.9510
65 G A -1.1757
66 S A -1.0954
67 G A -1.0284
68 T A -1.2946
69 D A -2.1598
70 F A 0.0000
71 T A -0.7676
72 L A 0.0000
73 T A -0.8108
74 I A 0.0000
75 S A -2.3916
76 R A -3.3594
77 L A 0.0000
78 E A -2.4336
79 P A -1.6456
80 E A -2.1642
81 D A 0.0000
82 F A -1.0876
83 A A 0.0000
84 V A 0.0000
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.2847
91 S A -0.6119
92 N A -1.8156
93 N A -2.0719
94 P A -1.7428
95 F A 0.0000
96 T A 0.0000
97 F A 0.1816
98 G A 0.0000
99 Q A -1.4882
100 G A 0.0000
101 T A 0.0000
102 K A -1.4149
103 L A 0.0000
104 E A -1.6633
105 I A -1.1519
106 K A -2.0209
107 G A -1.5837
108 G A -1.4336
109 G A -1.3175
110 G A -1.1588
111 S A -0.9901
112 G A -1.4350
113 G A -1.5105
114 G A -1.3581
115 G A -1.5619
116 S A -1.0596
117 G A -1.2477
118 G A -1.1882
119 G A -1.1956
120 G A -1.4298
121 S A -1.2260
122 Q A -1.7932
123 V A 0.0000
124 Q A -1.5230
125 L A 0.0000
126 V A 0.3125
127 Q A 0.0000
128 S A -0.5676
129 G A -0.5756
130 A A -0.0162
131 E A -0.0557
132 V A 0.9831
133 Q A -0.7209
134 K A -2.0205
135 P A -2.0519
136 G A -1.4270
137 A A -1.1256
138 S A -1.3193
139 V A 0.0000
140 K A -2.1026
141 V A 0.0000
142 S A -0.6585
143 C A 0.0000
144 K A -0.9826
145 A A 0.0000
146 S A -0.8075
147 G A -0.9270
148 Y A -0.6922
149 T A -0.7693
150 F A 0.0000
151 N A -2.1084
152 R A -2.3810
153 Y A -1.2374
154 T A -0.6193
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.1752
160 Q A -0.4414
161 A A -0.7387
162 P A -0.8274
163 G A -1.3843
164 Q A -1.3971
165 L A 0.0000
166 L A -0.1774
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.3577
171 I A 0.0000
172 N A -0.6342
173 P A 0.0000
174 S A -1.7269
175 R A -1.5266
176 G A -0.4459
177 Y A 1.0002
178 Y A 1.1285
179 N A -0.5627
180 Y A -1.4880
181 A A 0.0000
182 Q A -2.9703
183 K A -3.0018
184 F A 0.0000
185 K A -3.5970
186 D A -3.2376
187 R A -2.1623
188 V A 0.0000
189 T A -1.0392
190 M A 0.0000
191 T A -0.2875
192 R A -1.2356
193 D A -1.2631
194 T A -0.9034
195 S A -0.5790
196 T A -0.7001
197 S A -0.9261
198 T A 0.0000
199 V A 0.0000
200 Y A -0.8442
201 M A 0.0000
202 E A -1.5908
203 L A 0.0000
204 S A -1.2707
205 S A -1.1777
206 L A 0.0000
207 R A -2.6079
208 S A -2.1688
209 E A -2.3958
210 D A 0.0000
211 T A -0.8130
212 A A 0.0000
213 V A 0.0325
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.0386
221 D A -2.3902
222 D A -2.4504
223 H A -1.2513
224 Y A -0.3424
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1211
229 W A -0.0558
230 G A 0.0000
231 Q A -0.7672
232 G A -0.2592
233 T A 0.0000
234 T A -0.0006
235 V A 0.0000
236 T A -0.2460
237 V A 0.0000
238 S A -0.8146
239 S A -0.9428
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6598 2.0506 View CSV PDB
4.5 -0.7012 2.0528 View CSV PDB
5.0 -0.7508 2.059 View CSV PDB
5.5 -0.8001 2.0733 View CSV PDB
6.0 -0.8401 2.0983 View CSV PDB
6.5 -0.865 2.1313 View CSV PDB
7.0 -0.8742 2.1681 View CSV PDB
7.5 -0.872 2.2062 View CSV PDB
8.0 -0.8627 2.2448 View CSV PDB
8.5 -0.8473 2.2831 View CSV PDB
9.0 -0.8248 2.3203 View CSV PDB