Project name: AlaAla_R5

Status: done

Started: 2026-08-20 08:53:02
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:57)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/5b5b02210eb0fd6/tmp/folded.pdb                (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:58)
Show buried residues

Minimal score value
-2.6009
Maximal score value
2.1003
Average score
-0.5391
Total score value
-133.7015

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6996
2 V A 0.0000
3 Q A -2.0614
4 L A 0.0000
5 Q A -1.8558
6 E A 0.0000
7 S A -0.6814
8 G A -0.3542
9 P A 0.0560
10 G A 0.3914
11 L A 0.9746
12 V A 0.0000
13 K A -1.8342
14 P A -1.3744
15 S A -1.4864
16 Q A -2.0705
17 T A -1.7753
18 L A 0.0000
19 S A -1.0159
20 L A 0.0000
21 T A -0.6691
22 A A 0.0000
23 T A -1.2461
24 V A 0.0000
25 S A -1.3898
26 G A -1.4218
27 G A -1.0928
28 S A -0.7460
29 I A 0.0000
30 S A -0.2718
31 S A -0.2898
32 G A -0.2250
33 D A 0.1176
34 Y A 0.6754
35 Y A 0.6036
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6974
43 P A -0.6705
44 G A -1.1192
45 C A -1.1859
46 K A -2.0074
47 G A -1.1930
48 L A 0.0000
49 E A -0.7218
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1442
54 I A 0.0000
55 Y A 0.3939
56 Y A 0.2616
57 S A -0.1252
58 G A -0.2211
59 S A -0.2691
60 T A -0.2571
61 D A -0.7127
62 Y A -0.7003
63 N A -0.8974
64 P A -1.1811
65 S A -1.0688
66 L A 0.0000
67 K A -2.1026
68 S A -1.4876
69 R A -1.8213
70 V A 0.0000
71 T A -1.1576
72 M A 0.0000
73 S A -0.3858
74 V A -0.3824
75 D A -1.2258
76 T A -1.0431
77 S A -1.3498
78 K A -2.1788
79 N A -1.4631
80 Q A -1.2804
81 F A 0.0000
82 S A -0.5320
83 L A 0.0000
84 K A -1.6629
85 V A 0.0000
86 N A -2.1429
87 S A -1.6656
88 V A 0.0000
89 T A -0.7227
90 A A -0.2576
91 A A -0.0697
92 D A 0.0000
93 T A 0.2984
94 A A 0.0000
95 V A 0.2674
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.8208
103 I A 1.6415
104 F A 2.1003
105 G A 0.8825
106 V A 0.8847
107 G A 0.5655
108 T A 0.0000
109 F A 0.0000
110 D A -0.6393
111 Y A -0.6585
112 W A -0.8502
113 G A 0.0000
114 Q A -1.6278
115 G A -0.7319
116 T A -0.1651
117 L A 0.8844
118 V A 0.0000
119 T A 0.3590
120 V A 0.0000
121 S A -0.3805
122 S A -0.7054
123 A A -0.5472
124 A A -0.3582
125 G A -0.8355
126 G A -1.0724
127 G A -1.1480
128 G A -1.1703
129 S A -1.0166
130 G A -1.2045
131 G A -1.1863
132 G A -1.2332
133 G A -1.1806
134 S A -1.0948
135 G A -1.2174
136 G A -1.4022
137 G A -1.2289
138 G A -1.2784
139 S A -0.8984
140 D A -0.9203
141 I A 0.0000
142 V A 0.9389
143 M A 0.0000
144 T A -0.6057
145 Q A -0.6591
146 S A -0.7079
147 P A -0.3338
148 A A -0.3515
149 T A -0.4812
150 L A -0.2126
151 S A -0.3595
152 L A -0.5517
153 S A -0.8291
154 P A -1.3728
155 G A -1.6918
156 E A -2.1521
157 R A -2.6009
158 A A 0.0000
159 T A -0.6174
160 L A 0.0000
161 S A -0.8697
162 A A 0.0000
163 R A -2.3559
164 A A 0.0000
165 S A -0.9146
166 Q A -1.6182
167 S A -1.2913
168 V A 0.0000
169 S A -0.5581
170 S A -0.3319
171 Y A 0.3830
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.3874
179 P A -0.8402
180 G A -0.9541
181 C A -1.0810
182 Q A -1.4878
183 A A -1.1240
184 P A 0.0000
185 R A -1.3697
186 L A 0.0000
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2440
190 D A -0.4618
191 A A 0.0000
192 S A -0.9301
193 N A -1.2725
194 R A -1.4167
195 A A -0.9236
196 T A -0.5608
197 G A -0.5712
198 I A -0.5189
199 P A -0.3670
200 A A -0.3749
201 R A -0.7407
202 F A 0.0000
203 S A -0.6854
204 G A -0.6994
205 S A -0.8167
206 G A -1.1645
207 S A -1.0065
208 G A -1.1130
209 T A -1.7691
210 D A -2.1799
211 F A 0.0000
212 T A -0.7801
213 L A 0.0000
214 T A -0.6216
215 I A 0.0000
216 S A -1.4452
217 S A -1.7183
218 L A 0.0000
219 E A -2.1945
220 P A -1.4423
221 E A -2.2901
222 D A 0.0000
223 F A -0.6757
224 A A 0.0000
225 V A -0.5343
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.0000
232 G A -0.1688
233 S A -0.2898
234 T A -0.4030
235 P A -0.2459
236 L A 0.0000
237 T A 0.1516
238 F A 0.2271
239 G A 0.0000
240 G A -0.7752
241 G A -0.7229
242 T A 0.0000
243 K A -1.0339
244 A A 0.0000
245 E A -0.3949
246 I A 0.8611
247 K A -0.7613
248 A A -0.2876
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5057 4.9183 View CSV PDB
4.5 -0.5251 4.9158 View CSV PDB
5.0 -0.547 4.9092 View CSV PDB
5.5 -0.566 4.8945 View CSV PDB
6.0 -0.5759 4.8704 View CSV PDB
6.5 -0.5727 4.84 View CSV PDB
7.0 -0.5573 4.8067 View CSV PDB
7.5 -0.5341 4.7724 View CSV PDB
8.0 -0.5065 4.7378 View CSV PDB
8.5 -0.4759 4.7031 View CSV PDB
9.0 -0.4426 4.6687 View CSV PDB