Project name: PfHAase [mutate: DR148A, GA82A, GA42A, CA153A, NA210A]

Status: done

Started: 2026-06-24 16:05:28
Chain sequence(s) A: MYTLHWDVNSSNFLDYFVFDTEADPTAGFVKYVDQSTASNDGLYSTSNNQIYLGVDKTTVLDSSSTGRNSVRVYSQNTFSSGILITDFAHLPVSVCGIWPAYWTINNQANPYGEIDIMEAYDDVAGAYVSLHTSNTCTLSNRNFTGTDTRTDCTLSSGGGCGVQSTSSQFGAGFNAAGGGVWVLSLENSLQLWVFPRNQIPADITNGSPNPSSWGTPLFEFDSNNGCDVSSNFIDQTVIFNLDFCGQNGAGGQEWSDWTDCATTTGQSTCNAYVAANPSAYSETYFSINSIKLYQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues GA82A,DR148A,GA42A,NA210A,CA153A
Energy difference between WT (input) and mutated protein (by FoldX) 12.7309 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:12)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:12)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:12)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:12)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       FoldX:    Building mutant model                                                       (00:01:30)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/5d1836b16e0d65d/tmp/folded.pdb                (00:02:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:26)
Show buried residues

Minimal score value
-2.601
Maximal score value
1.2526
Average score
-0.5821
Total score value
-171.7153

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.0326
2 Y A 0.5807
3 T A 0.3511
4 L A 0.2830
5 H A -0.6976
6 W A 0.0000
7 D A -1.0472
8 V A 0.0000
9 N A -0.9192
10 S A -0.9181
11 S A -0.8120
12 N A -0.8209
13 F A 0.0000
14 L A 0.0657
15 D A -1.3677
16 Y A -0.7934
17 F A 0.0000
18 V A 0.4450
19 F A -0.1064
20 D A -0.8813
21 T A -1.5679
22 E A -2.2680
23 A A -1.2804
24 D A -1.0433
25 P A -0.6437
26 T A -0.7695
27 A A -0.6375
28 G A -0.7769
29 F A 0.0000
30 V A 0.0000
31 K A -1.5438
32 Y A 0.0000
33 V A 0.0000
34 D A -1.6926
35 Q A -1.2698
36 S A -1.3963
37 T A -1.6289
38 A A 0.0000
39 S A -1.5998
40 N A -2.3033
41 D A -2.5606
42 A A -1.3493 mutated: GA42A
43 L A 0.0000
44 Y A 0.0000
45 S A -0.7580
46 T A -0.9298
47 S A -1.2816
48 N A -2.0555
49 N A -2.1734
50 Q A -1.4297
51 I A 0.0000
52 Y A -0.0234
53 L A 0.0000
54 G A -0.3951
55 V A 0.0000
56 D A -0.9605
57 K A -1.1395
58 T A -0.2610
59 T A 0.2962
60 V A 1.2526
61 L A 0.1009
62 D A -1.4986
63 S A -0.9503
64 S A -0.9542
65 S A -0.9643
66 T A -0.7441
67 G A 0.0000
68 R A 0.0000
69 N A -1.0109
70 S A 0.0000
71 V A 0.0000
72 R A 0.0000
73 V A 0.0000
74 Y A 0.3222
75 S A 0.0000
76 Q A -1.5184
77 N A -1.7325
78 T A -1.2351
79 F A 0.0000
80 S A -0.5587
81 S A -0.7784
82 A A 0.0000 mutated: GA82A
83 I A 0.0000
84 L A 0.0000
85 I A 0.0000
86 T A 0.0000
87 D A -0.5467
88 F A 0.0000
89 A A -0.3747
90 H A -0.3421
91 L A 0.0000
92 P A 0.0000
93 V A -0.3623
94 S A -0.6402
95 V A -0.5086
96 C A 0.0000
97 G A 0.0000
98 I A 0.0000
99 W A -0.1891
100 P A 0.0000
101 A A 0.0000
102 Y A 0.0000
103 W A 0.1513
104 T A 0.0000
105 I A -0.3820
106 N A 0.0000
107 N A -2.0826
108 Q A -2.2303
109 A A -1.5218
110 N A -1.9523
111 P A -1.3413
112 Y A -0.6628
113 G A 0.0000
114 E A -0.0707
115 I A 0.0000
116 D A 0.0000
117 I A 0.0000
118 M A 0.0000
119 E A -0.2395
120 A A 0.0000
121 Y A -0.3233
122 D A 0.0000
123 D A -1.8325
124 V A -0.6527
125 A A -0.4158
126 G A 0.0000
127 A A 0.0000
128 Y A 0.0000
129 V A 0.0000
130 S A 0.0000
131 L A 0.0000
132 H A -0.3454
133 T A 0.0000
134 S A -0.6086
135 N A -1.1852
136 T A -0.7179
137 C A 0.0000
138 T A -1.0243
139 L A 0.0000
140 S A -1.6736
141 N A -2.0819
142 R A -2.6010
143 N A -2.2382
144 F A -1.2038
145 T A -0.6032
146 G A -0.9040
147 T A -1.0829
148 R A -2.0540 mutated: DR148A
149 T A -1.5830
150 R A -1.4180
151 T A -1.1873
152 D A -1.4317
153 A A 0.0000 mutated: CA153A
154 T A -0.5012
155 L A 0.1446
156 S A -0.2566
157 S A -0.6361
158 G A -0.8210
159 G A -0.9002
160 G A 0.0000
161 C A 0.0000
162 G A 0.0000
163 V A 0.0000
164 Q A -0.8786
165 S A 0.0000
166 T A -0.3481
167 S A -0.4027
168 S A -0.4863
169 Q A -0.4223
170 F A 0.0000
171 G A 0.0000
172 A A -0.3381
173 G A -0.4315
174 F A 0.0000
175 N A -0.4586
176 A A -0.2494
177 A A -0.6464
178 G A -0.7791
179 G A 0.0000
180 G A 0.0000
181 V A 0.0000
182 W A 0.0000
183 V A 0.0000
184 L A 0.0000
185 S A 0.0000
186 L A 0.0000
187 E A -1.4584
188 N A -2.1399
189 S A 0.0000
190 L A 0.0000
191 Q A -0.5622
192 L A 0.0000
193 W A 0.0000
194 V A 0.0000
195 F A 0.0000
196 P A -1.1961
197 R A -1.5808
198 N A -2.0753
199 Q A -1.8357
200 I A -0.8863
201 P A -0.7244
202 A A -0.6283
203 D A -0.8797
204 I A 0.0000
205 T A -0.8161
206 N A -1.5795
207 G A -0.8480
208 S A -0.3564
209 P A 0.0000
210 A A -0.0509 mutated: NA210A
211 P A -0.3629
212 S A -0.4265
213 S A -0.5069
214 W A 0.0000
215 G A -0.5830
216 T A -0.6373
217 P A 0.0000
218 L A 0.0000
219 F A 0.0000
220 E A -1.0148
221 F A 0.0000
222 D A -2.1759
223 S A -2.2250
224 N A -2.4864
225 N A -2.3263
226 G A -1.6033
227 C A -1.4101
228 D A -2.0870
229 V A 0.0000
230 S A -1.0116
231 S A -0.8762
232 N A 0.0000
233 F A 0.0000
234 I A -0.5649
235 D A -1.5594
236 Q A 0.0000
237 T A 0.0000
238 V A 0.0000
239 I A 0.0000
240 F A 0.0000
241 N A -0.0412
242 L A 0.0000
243 D A 0.0000
244 F A 0.0000
245 C A 0.0000
246 G A -1.1976
247 Q A -2.0956
248 N A -2.2055
249 G A 0.0000
250 A A 0.0000
251 G A 0.0000
252 G A -1.7047
253 Q A -1.9032
254 E A 0.0000
255 W A 0.0000
256 S A -1.6561
257 D A -2.0543
258 W A -0.3688
259 T A -1.3634
260 D A -2.3070
261 C A 0.0000
262 A A -1.1195
263 T A -1.1721
264 T A -0.8188
265 T A -0.7310
266 G A -0.9224
267 Q A -0.7909
268 S A -0.6100
269 T A -0.5238
270 C A 0.0000
271 N A -0.7848
272 A A -0.6475
273 Y A -0.2802
274 V A 0.0000
275 A A 0.0000
276 A A 0.1038
277 N A -0.1021
278 P A -0.2287
279 S A -0.6645
280 A A -0.5678
281 Y A 0.0000
282 S A -0.9541
283 E A -1.2305
284 T A 0.0000
285 Y A -0.0320
286 F A 0.0000
287 S A 0.0000
288 I A 0.0000
289 N A -0.9307
290 S A -0.8291
291 I A 0.0000
292 K A -0.7636
293 L A 0.0000
294 Y A 0.0000
295 Q A -0.5481
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3381 2.9211 View CSV PDB
4.5 -0.3852 2.6525 View CSV PDB
5.0 -0.4389 2.3618 View CSV PDB
5.5 -0.4944 2.063 View CSV PDB
6.0 -0.5478 1.7617 View CSV PDB
6.5 -0.5968 1.6056 View CSV PDB
7.0 -0.6408 1.5445 View CSV PDB
7.5 -0.6804 1.5064 View CSV PDB
8.0 -0.7146 1.4857 View CSV PDB
8.5 -0.7406 1.4763 View CSV PDB
9.0 -0.7559 1.4728 View CSV PDB