Chain sequence(s) |
A: EMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKF
input PDB |
Selected Chain(s) | A |
Distance of aggregation | 5 Å |
FoldX usage | Yes |
pH calculations | No |
alphaCutter usage | No |
Dynamic mode | No |
Automated mutations | Yes |
Downloads | Download all the data |
Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:03) [WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow to prevent this behavior) (00:00:03) [INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:03) [INFO] runJob: Creating pdb object from: input.pdb (00:00:03) [INFO] FoldX: Starting FoldX energy minimization (00:00:03) [INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:04:19) [INFO] AutoMut: Residue number 182 from chain A and a score of 1.688 (phenylalanine) selected for automated mutation (00:04:21) [INFO] AutoMut: Residue number 280 from chain A and a score of 1.628 (phenylalanine) selected for automated mutation (00:04:21) [INFO] AutoMut: Residue number 119 from chain A and a score of 1.590 (leucine) selected for automated mutation (00:04:21) [INFO] AutoMut: Residue number 149 from chain A and a score of 1.429 (isoleucine) selected for automated mutation (00:04:21) [INFO] AutoMut: Residue number 114 from chain A and a score of 1.251 (methionine) selected for automated mutation (00:04:21) [INFO] AutoMut: Residue number 134 from chain A and a score of 1.036 (isoleucine) selected for automated mutation (00:04:21) [INFO] AutoMut: Mutating residue number 182 from chain A (phenylalanine) into glutamic acid Mutating residue number 182 from chain A (phenylalanine) into glutamic acid (00:04:21) [INFO] AutoMut: Mutating residue number 182 from chain A (phenylalanine) into aspartic acid Mutating residue number 182 from chain A (phenylalanine) into aspartic acid (00:04:21) [INFO] AutoMut: Mutating residue number 280 from chain A (phenylalanine) into glutamic acid Mutating residue number 280 from chain A (phenylalanine) into glutamic acid (00:04:21) [INFO] AutoMut: Mutating residue number 182 from chain A (phenylalanine) into arginine (00:04:30) [INFO] AutoMut: Mutating residue number 182 from chain A (phenylalanine) into lysine (00:04:31) [INFO] AutoMut: Mutating residue number 280 from chain A (phenylalanine) into lysine (00:04:41) [INFO] AutoMut: Mutating residue number 280 from chain A (phenylalanine) into aspartic acid Mutating residue number 280 from chain A (phenylalanine) into aspartic acid (00:04:49) [INFO] AutoMut: Mutating residue number 119 from chain A (leucine) into glutamic acid (00:04:50) [INFO] AutoMut: Mutating residue number 119 from chain A (leucine) into lysine (00:05:03) [INFO] AutoMut: Mutating residue number 280 from chain A (phenylalanine) into arginine (00:05:09) [INFO] AutoMut: Mutating residue number 119 from chain A (leucine) into aspartic acid (00:05:10) [INFO] AutoMut: Mutating residue number 119 from chain A (leucine) into arginine (00:05:21) [INFO] AutoMut: Mutating residue number 149 from chain A (isoleucine) into glutamic acid (00:05:26) [INFO] AutoMut: Mutating residue number 149 from chain A (isoleucine) into aspartic acid (00:05:36) [INFO] AutoMut: Mutating residue number 149 from chain A (isoleucine) into lysine (00:05:37) [INFO] AutoMut: Mutating residue number 114 from chain A (methionine) into glutamic acid (00:05:41) [INFO] AutoMut: Mutating residue number 149 from chain A (isoleucine) into arginine (00:05:44) [INFO] AutoMut: Mutating residue number 114 from chain A (methionine) into lysine (00:05:52) [INFO] AutoMut: Mutating residue number 114 from chain A (methionine) into aspartic acid (00:05:52) [INFO] AutoMut: Mutating residue number 134 from chain A (isoleucine) into glutamic acid (00:05:58) [INFO] AutoMut: Mutating residue number 114 from chain A (methionine) into arginine (00:06:06) [INFO] AutoMut: Mutating residue number 134 from chain A (isoleucine) into aspartic acid (00:06:07) [INFO] AutoMut: Mutating residue number 134 from chain A (isoleucine) into lysine (00:06:13) [INFO] AutoMut: Mutating residue number 134 from chain A (isoleucine) into arginine (00:06:22) [INFO] AutoMut: Effect of mutation residue number 182 from chain A (phenylalanine) into glutamic acid: Energy difference: -0.0952 kcal/mol, Difference in average score from the base case: -0.0204 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 182 from chain A (phenylalanine) into lysine: Energy difference: 0.0822 kcal/mol, Difference in average score from the base case: -0.0191 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 182 from chain A (phenylalanine) into aspartic acid: Energy difference: 0.0502 kcal/mol, Difference in average score from the base case: -0.0210 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 182 from chain A (phenylalanine) into arginine: Energy difference: -0.0721 kcal/mol, Difference in average score from the base case: -0.0186 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 280 from chain A (phenylalanine) into glutamic acid: Energy difference: 1.5773 kcal/mol, Difference in average score from the base case: -0.0176 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 280 from chain A (phenylalanine) into lysine: Energy difference: 1.0983 kcal/mol, Difference in average score from the base case: -0.0159 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 280 from chain A (phenylalanine) into aspartic acid: Energy difference: 1.7604 kcal/mol, Difference in average score from the base case: -0.0186 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 280 from chain A (phenylalanine) into arginine: Energy difference: -0.5476 kcal/mol, Difference in average score from the base case: -0.0197 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 119 from chain A (leucine) into glutamic acid: Energy difference: 0.5009 kcal/mol, Difference in average score from the base case: -0.0181 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 119 from chain A (leucine) into lysine: Energy difference: 0.5889 kcal/mol, Difference in average score from the base case: -0.0175 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 119 from chain A (leucine) into aspartic acid: Energy difference: 0.3937 kcal/mol, Difference in average score from the base case: -0.0181 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 119 from chain A (leucine) into arginine: Energy difference: 1.0902 kcal/mol, Difference in average score from the base case: -0.0198 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 149 from chain A (isoleucine) into glutamic acid: Energy difference: -0.4954 kcal/mol, Difference in average score from the base case: -0.0193 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 149 from chain A (isoleucine) into lysine: Energy difference: -0.3312 kcal/mol, Difference in average score from the base case: -0.0182 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 149 from chain A (isoleucine) into aspartic acid: Energy difference: -0.7444 kcal/mol, Difference in average score from the base case: -0.0209 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 149 from chain A (isoleucine) into arginine: Energy difference: -0.1721 kcal/mol, Difference in average score from the base case: -0.0188 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 114 from chain A (methionine) into glutamic acid: Energy difference: 0.1916 kcal/mol, Difference in average score from the base case: -0.0134 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 114 from chain A (methionine) into lysine: Energy difference: -0.2374 kcal/mol, Difference in average score from the base case: -0.0131 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 114 from chain A (methionine) into aspartic acid: Energy difference: 1.1139 kcal/mol, Difference in average score from the base case: -0.0132 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 114 from chain A (methionine) into arginine: Energy difference: 0.0984 kcal/mol, Difference in average score from the base case: -0.0146 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 134 from chain A (isoleucine) into glutamic acid: Energy difference: 1.2514 kcal/mol, Difference in average score from the base case: -0.0139 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 134 from chain A (isoleucine) into lysine: Energy difference: 0.1218 kcal/mol, Difference in average score from the base case: -0.0141 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 134 from chain A (isoleucine) into aspartic acid: Energy difference: 2.2574 kcal/mol, Difference in average score from the base case: -0.0137 (00:06:46) [INFO] AutoMut: Effect of mutation residue number 134 from chain A (isoleucine) into arginine: Energy difference: 0.2033 kcal/mol, Difference in average score from the base case: -0.0147 (00:06:46) [INFO] Main: Simulation completed successfully. (00:06:52) |
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
residue index | residue name | chain | Aggrescan4D score | mutation |
---|---|---|---|---|
2 | E | A | -1.9189 | |
3 | M | A | 0.0000 | |
4 | E | A | -1.4481 | |
5 | K | A | -2.0333 | |
6 | E | A | -1.1147 | |
7 | F | A | -0.3764 | |
8 | E | A | -1.9336 | |
9 | Q | A | -1.3999 | |
10 | I | A | 0.0000 | |
11 | D | A | -0.9145 | |
12 | K | A | -1.8496 | |
13 | S | A | -0.6099 | |
14 | G | A | -0.5172 | |
15 | S | A | -0.1495 | |
16 | W | A | 0.0000 | |
17 | A | A | 0.0657 | |
18 | A | A | 0.1188 | |
19 | I | A | 0.3793 | |
20 | Y | A | 0.0000 | |
21 | Q | A | -0.9837 | |
22 | D | A | -1.9097 | |
23 | I | A | 0.0000 | |
24 | R | A | -1.9074 | |
25 | H | A | -1.6469 | |
26 | E | A | -2.0008 | |
27 | A | A | -0.3347 | |
28 | S | A | -0.3887 | |
29 | D | A | -1.6339 | |
30 | F | A | 0.5398 | |
31 | P | A | -0.0005 | |
32 | C | A | -0.2697 | |
33 | R | A | -1.7659 | |
34 | V | A | -0.0242 | |
35 | A | A | 0.0000 | |
36 | K | A | -1.6010 | |
37 | L | A | 0.1823 | |
38 | P | A | -0.4650 | |
39 | K | A | -1.7463 | |
40 | N | A | 0.0000 | |
41 | K | A | -1.9335 | |
42 | N | A | -1.6256 | |
43 | R | A | -0.4881 | |
44 | N | A | -0.2774 | |
45 | R | A | -0.2945 | |
46 | Y | A | -0.0317 | |
47 | R | A | -2.1032 | |
48 | D | A | -2.1260 | |
49 | V | A | 0.0000 | |
50 | S | A | 0.0000 | |
51 | P | A | 0.0000 | |
52 | F | A | 0.0000 | |
53 | D | A | -0.4656 | |
54 | H | A | -1.0423 | |
55 | S | A | 0.0000 | |
56 | R | A | -0.3056 | |
57 | I | A | 0.0000 | |
58 | K | A | -1.7000 | |
59 | L | A | 0.0000 | |
60 | H | A | -1.1255 | |
61 | Q | A | -1.2544 | |
62 | E | A | -2.2818 | |
63 | D | A | -2.1727 | |
64 | N | A | -0.6699 | |
65 | D | A | -0.3951 | |
66 | Y | A | 0.0000 | |
67 | I | A | 0.0000 | |
68 | N | A | 0.0000 | |
69 | A | A | 0.0000 | |
70 | S | A | 0.0000 | |
71 | L | A | 0.2082 | |
72 | I | A | 0.0000 | |
73 | K | A | -1.6069 | |
74 | M | A | 0.0000 | |
75 | E | A | -2.0021 | |
76 | E | A | -1.3200 | |
77 | A | A | -0.3942 | |
78 | Q | A | -1.2498 | |
79 | R | A | -0.5191 | |
80 | S | A | -0.3417 | |
81 | Y | A | 0.0000 | |
82 | I | A | 0.0000 | |
83 | L | A | 0.0000 | |
84 | T | A | 0.0000 | |
85 | Q | A | 0.0000 | |
86 | G | A | 0.0000 | |
87 | P | A | 0.0000 | |
88 | L | A | 0.1580 | |
89 | P | A | -0.4502 | |
90 | N | A | -1.3197 | |
91 | T | A | 0.0000 | |
92 | C | A | 0.0000 | |
93 | G | A | 0.0000 | |
94 | H | A | 0.0000 | |
95 | F | A | 0.0000 | |
96 | W | A | 0.0000 | |
97 | E | A | 0.0000 | |
98 | M | A | 0.0000 | |
99 | V | A | 0.0000 | |
100 | W | A | 0.0000 | |
101 | E | A | -0.6033 | |
102 | Q | A | -0.6594 | |
103 | K | A | -1.7523 | |
104 | S | A | 0.0000 | |
105 | R | A | -0.3518 | |
106 | G | A | 0.0000 | |
107 | V | A | 0.0000 | |
108 | V | A | 0.0000 | |
109 | M | A | 0.0000 | |
110 | L | A | 0.0000 | |
111 | N | A | 0.0000 | |
112 | R | A | -0.3501 | |
113 | V | A | 0.3866 | |
114 | M | A | 1.2511 | |
115 | E | A | 0.0000 | |
116 | K | A | -1.7859 | |
117 | G | A | -0.8004 | |
118 | S | A | 0.0815 | |
119 | L | A | 1.5896 | |
120 | K | A | -0.0797 | |
121 | C | A | 0.0000 | |
122 | A | A | -0.0790 | |
123 | Q | A | -0.4632 | |
124 | Y | A | 0.0000 | |
125 | W | A | 0.0000 | |
126 | P | A | 0.0000 | |
127 | Q | A | -1.5105 | |
128 | K | A | -2.2538 | |
129 | E | A | -2.4684 | |
130 | E | A | -2.4710 | |
131 | K | A | -2.2959 | |
132 | E | A | -1.6795 | |
133 | M | A | 0.1480 | |
134 | I | A | 1.0362 | |
135 | F | A | 0.0000 | |
136 | E | A | -2.2200 | |
137 | D | A | -2.1279 | |
138 | T | A | 0.0000 | |
139 | N | A | -0.7988 | |
140 | L | A | 0.0000 | |
141 | K | A | -0.3239 | |
142 | L | A | 0.0000 | |
143 | T | A | -0.1797 | |
144 | L | A | 0.0000 | |
145 | I | A | 0.6135 | |
146 | S | A | -0.1314 | |
147 | E | A | -1.0583 | |
148 | D | A | -1.5446 | |
149 | I | A | 1.4295 | |
150 | K | A | -1.0405 | |
151 | S | A | -0.4067 | |
152 | Y | A | 0.2957 | |
153 | Y | A | 0.0000 | |
154 | T | A | 0.0000 | |
155 | V | A | 0.0000 | |
156 | R | A | -0.3683 | |
157 | Q | A | -0.4301 | |
158 | L | A | 0.0000 | |
159 | E | A | -0.7576 | |
160 | L | A | 0.0000 | |
161 | E | A | 0.0000 | |
162 | N | A | -0.0800 | |
163 | L | A | 0.2957 | |
164 | T | A | 0.0018 | |
165 | T | A | -0.3020 | |
166 | Q | A | -1.3763 | |
167 | E | A | -1.3949 | |
168 | T | A | -0.3632 | |
169 | R | A | -0.6609 | |
170 | E | A | -0.8741 | |
171 | I | A | 0.0000 | |
172 | L | A | 0.1735 | |
173 | H | A | 0.0000 | |
174 | F | A | 0.0000 | |
175 | H | A | 0.0000 | |
176 | Y | A | 0.0000 | |
177 | T | A | -0.0227 | |
178 | T | A | -0.0493 | |
179 | W | A | 0.0000 | |
180 | P | A | -0.2242 | |
181 | D | A | -0.5579 | |
182 | F | A | 1.6877 | |
183 | G | A | -0.0372 | |
184 | V | A | 0.2737 | |
185 | P | A | 0.0000 | |
186 | E | A | -1.8486 | |
187 | S | A | -0.4916 | |
188 | P | A | 0.0000 | |
189 | A | A | 0.0269 | |
190 | S | A | -0.0480 | |
191 | F | A | 0.0000 | |
192 | L | A | 0.0000 | |
193 | N | A | -1.0282 | |
194 | F | A | 0.0000 | |
195 | L | A | 0.0000 | |
196 | F | A | 0.2389 | |
197 | K | A | -0.4378 | |
198 | V | A | 0.0000 | |
199 | R | A | -0.8573 | |
200 | E | A | -1.9322 | |
201 | S | A | -0.4111 | |
202 | G | A | -0.1618 | |
203 | S | A | 0.0000 | |
204 | L | A | 0.0000 | |
205 | S | A | -0.0797 | |
206 | P | A | -0.5948 | |
207 | E | A | -1.9554 | |
208 | H | A | -0.8274 | |
209 | G | A | -0.3703 | |
210 | P | A | -0.0412 | |
211 | V | A | 0.0000 | |
212 | V | A | 0.0000 | |
213 | V | A | 0.0000 | |
214 | H | A | 0.0000 | |
215 | C | A | 0.0000 | |
216 | S | A | 0.0000 | |
217 | A | A | 0.0077 | |
218 | G | A | 0.0000 | |
219 | I | A | 0.0000 | |
220 | G | A | 0.0000 | |
221 | R | A | -0.2178 | |
222 | S | A | 0.0000 | |
223 | G | A | 0.0000 | |
224 | T | A | 0.0000 | |
225 | F | A | 0.0000 | |
226 | C | A | 0.0000 | |
227 | L | A | 0.0000 | |
228 | A | A | 0.0000 | |
229 | D | A | 0.0000 | |
230 | T | A | 0.0000 | |
231 | C | A | 0.0000 | |
232 | L | A | 0.0000 | |
233 | L | A | 0.2578 | |
234 | L | A | 0.0000 | |
235 | M | A | -0.1949 | |
236 | D | A | -2.0740 | |
237 | K | A | -2.1490 | |
238 | R | A | -1.2726 | |
239 | K | A | -2.0148 | |
240 | D | A | -1.4001 | |
241 | P | A | -0.3340 | |
242 | S | A | -0.1906 | |
243 | S | A | -0.1488 | |
244 | V | A | 0.0000 | |
245 | D | A | -0.5098 | |
246 | I | A | 0.0000 | |
247 | K | A | -0.7473 | |
248 | K | A | -1.7798 | |
249 | V | A | 0.0000 | |
250 | L | A | 0.0000 | |
251 | L | A | -0.0022 | |
252 | E | A | -1.2608 | |
253 | M | A | 0.0000 | |
254 | R | A | 0.0000 | |
255 | K | A | -0.8359 | |
256 | F | A | 0.1125 | |
257 | R | A | 0.0000 | |
258 | M | A | 0.2592 | |
259 | G | A | -0.0243 | |
260 | L | A | 0.0000 | |
261 | I | A | 0.0000 | |
262 | Q | A | -1.2019 | |
263 | T | A | -0.2345 | |
264 | A | A | -0.2953 | |
265 | D | A | -1.7082 | |
266 | Q | A | 0.0000 | |
267 | L | A | 0.0000 | |
268 | R | A | -0.7970 | |
269 | F | A | 0.0000 | |
270 | S | A | 0.0000 | |
271 | Y | A | 0.0000 | |
272 | L | A | 0.2538 | |
273 | A | A | 0.0000 | |
274 | V | A | 0.0000 | |
275 | I | A | 0.0797 | |
276 | E | A | -0.7220 | |
277 | G | A | 0.0000 | |
278 | A | A | -0.2874 | |
279 | K | A | -1.3384 | |
280 | F | A | 1.6284 |
Automated mutations analysis - charged mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
ID149A | -0.7444 | -0.0209 | View | CSV | PDB |
FR280A | -0.5476 | -0.0197 | View | CSV | PDB |
IE149A | -0.4954 | -0.0193 | View | CSV | PDB |
FE182A | -0.0952 | -0.0204 | View | CSV | PDB |
FR182A | -0.0721 | -0.0186 | View | CSV | PDB |
MK114A | -0.2374 | -0.0131 | View | CSV | PDB |
MR114A | 0.0984 | -0.0146 | View | CSV | PDB |
IK134A | 0.1218 | -0.0141 | View | CSV | PDB |
IR134A | 0.2033 | -0.0147 | View | CSV | PDB |
LD119A | 0.3937 | -0.0181 | View | CSV | PDB |
LE119A | 0.5009 | -0.0181 | View | CSV | PDB |
FK280A | 1.0983 | -0.0159 | View | CSV | PDB |