Project name: e3849a9058c7c93 [mutate: VR3A, AR4A, AR5A, WA6A, TR7A, LR8A, VR19A, IR64A, PR65A, LR66A, PR67A, VR68A, WR70A, WR72A, WR74A, PR73A, IR86A, FR92A, LR99A, IR104A, LR112A, VR178A, LR179A, FR180A, IR189A, LR190A, IR210A, AR211A, AR212A, AR213A, LR214A, AR215A, AR222A, YR223A, IR224A, PR225A, LR226A, PR227A, VR228A, WR230A, WR232A, AR233A, AR234A, YR235A, LR236A, PR237A, VR238A, WR240A, WR242A, PR243A, WR244A, AR245A, AR246A, YR247A, MR248A, AR249A, IR252A, VR253A, AR256A, AR257A, YR258A, LR259A]

Status: done

Started: 2026-04-14 19:37:50
Chain sequence(s) A: AKVAAWTLKAAACEAAAKVARAGGNSDATAGPGPGQADWDTGHRIDTAGPREGPGPGERVNGRIPLPVDWRWPWGGPGPGDDYEGIGGHESFRGPGPGLAAGSIKPIRGDILELRWHEANGPGPGSIKPIRGDILELRWHGPGPGRNTIERISRRFGIRVGPGPGELRWHEANNHFRVLFGPGPGRGDILELRWHEANNHGPGPGATAEIAAALAARQADAAYIPLPVDWRWAAYLPVDWRWPWAAYMADRIVARAAYLVLEVPTLRAAYSVDGRPVFK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues AR256A,AR257A,LR112A,IR252A,WR232A,VR19A,AR233A,PR243A,YR258A,LR259A,AR212A,AR213A,IR210A,AR211A,LR99A,LR214A,AR215A,AR245A,VR253A,VR238A,LR179A,VR178A,WR74A,PR73A,WR72A,WR70A,VR3A,AR5A,AR4A,TR7A,WA6A,LR8A,FR92A,FR180A,WR240A,IR104A,WR242A,IR86A,WR244A,YR247A,AR246A,AR249A,MR248A,IR189A,PR227A,LR226A,PR225A,IR224A,YR223A,AR222A,VR228A,AR234A,VR68A,WR230A,YR235A,IR64A,PR65A,LR66A,PR67A,LR236A,PR237A,LR190A
Energy difference between WT (input) and mutated protein (by FoldX) 14.875 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:36)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:44:02)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/5ef3ab045f769d0/tmp/folded.pdb                (00:44:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:45:12)
Show buried residues

Minimal score value
-6.1611
Maximal score value
1.7746
Average score
-2.5542
Total score value
-712.6182

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A A -2.4235
2 K A -4.0258
3 R A -5.0275 mutated: VR3A
4 R A -5.4924 mutated: AR4A
5 R A -5.5197 mutated: AR5A
6 A A -4.5749 mutated: WA6A
7 R A -5.0961 mutated: TR7A
8 R A -4.9748 mutated: LR8A
9 K A -4.1362
10 A A -2.6953
11 A A -2.1977
12 A A -1.6926
13 C A -1.3704
14 E A -2.5842
15 A A -1.8412
16 A A -1.7021
17 A A -2.2853
18 K A -3.6190
19 R A -3.6006 mutated: VR19A
20 A A -2.6768
21 R A -3.3856
22 A A -2.5378
23 G A -2.3833
24 G A -2.2751
25 N A -2.4069
26 S A -1.9266
27 D A -2.2404
28 A A -1.0756
29 T A -0.6337
30 A A -0.4776
31 G A -0.7070
32 P A -0.8047
33 G A -0.9127
34 P A -1.0589
35 G A -1.4873
36 Q A -1.7551
37 A A -1.4659
38 D A -1.9646
39 W A -0.6883
40 D A -2.0835
41 T A -1.3691
42 G A -1.6485
43 H A -2.0275
44 R A -2.1186
45 I A -0.0771
46 D A -1.4575
47 T A -0.7956
48 A A -0.7739
49 G A -1.4369
50 P A -1.9449
51 R A -3.1154
52 E A -3.1881
53 G A -2.1292
54 P A -1.6450
55 G A -1.4165
56 P A -1.3817
57 G A -1.8165
58 E A -2.5345
59 R A -3.1441
60 V A -1.2577
61 N A -2.0582
62 G A -2.7365
63 R A -3.9954
64 R A -4.5884 mutated: IR64A
65 R A -5.0811 mutated: PR65A
66 R A -4.8748 mutated: LR66A
67 R A -4.7740 mutated: PR67A
68 R A -4.6110 mutated: VR68A
69 D A -4.1918
70 R A -4.5884 mutated: WR70A
71 R A -4.8205
72 R A -4.8856 mutated: WR72A
73 R A -4.5075 mutated: PR73A
74 R A -3.8408 mutated: WR74A
75 G A -2.6118
76 G A -1.6544
77 P A -0.9187
78 G A -1.3135
79 P A -1.5537
80 G A -1.9246
81 D A -2.9128
82 D A -2.7261
83 Y A -1.3910
84 E A -2.8337
85 G A -2.5413
86 R A -3.0421 mutated: IR86A
87 G A -2.4873
88 G A -2.1072
89 H A -2.7190
90 E A -3.6637
91 S A -2.7640
92 R A -3.4843 mutated: FR92A
93 R A -3.2367
94 G A -1.8740
95 P A -1.4083
96 G A -1.2113
97 P A -1.2991
98 G A -1.8085
99 R A -2.4757 mutated: LR99A
100 A A -1.7438
101 A A -1.4408
102 G A -1.8096
103 S A -2.2304
104 R A -3.2744 mutated: IR104A
105 K A -3.1625
106 P A -2.6532
107 I A -2.2308
108 R A -2.8428
109 G A -2.2943
110 D A -3.0293
111 I A -2.8353
112 R A -3.5880 mutated: LR112A
113 E A 0.0000
114 L A -2.2088
115 R A -2.5234
116 W A 0.0000
117 H A -1.9886
118 E A -2.2159
119 A A -1.8930
120 N A -2.1828
121 G A -1.7071
122 P A -1.4102
123 G A -1.3918
124 P A -1.5331
125 G A 0.0000
126 S A -1.6812
127 I A 0.0000
128 K A -1.9506
129 P A -1.4468
130 I A -0.5069
131 R A -2.1768
132 G A -1.7721
133 D A -2.2688
134 I A -1.2186
135 L A -0.9210
136 E A -1.4206
137 L A -1.4349
138 R A -2.4312
139 W A -1.6283
140 H A -1.8161
141 G A -1.4616
142 P A -1.0077
143 G A -1.3689
144 P A -1.3128
145 G A -1.8196
146 R A -2.9476
147 N A -2.7631
148 T A -2.0379
149 I A 0.0000
150 E A -3.1013
151 R A -2.5768
152 I A 0.0000
153 S A 0.0000
154 R A -3.3155
155 R A -2.7746
156 F A -1.3398
157 G A -1.8369
158 I A 0.0000
159 R A -2.0180
160 V A -0.6667
161 G A -0.3568
162 P A -0.5290
163 G A -0.7940
164 P A -1.7547
165 G A -2.5666
166 E A 0.0000
167 L A 0.0000
168 R A -1.7663
169 W A -1.8074
170 H A -2.2306
171 E A -2.6797
172 A A -1.6481
173 N A -1.8264
174 N A -2.3027
175 H A -1.9477
176 F A -1.9908
177 R A -2.8505
178 R A -3.2782 mutated: VR178A
179 R A -4.5800 mutated: LR179A
180 R A -4.2944 mutated: FR180A
181 G A -3.4559
182 P A -2.1207
183 G A -1.4019
184 P A -1.4358
185 G A -2.0179
186 R A -3.3111
187 G A -3.5526
188 D A -4.5762
189 R A -4.6933 mutated: IR189A
190 R A -4.6451 mutated: LR190A
191 E A -2.8548
192 L A -1.7074
193 R A -2.1905
194 W A -1.2243
195 H A -2.1196
196 E A -3.0374
197 A A -2.0574
198 N A -3.0107
199 N A -2.7645
200 H A -2.5118
201 G A -1.7010
202 P A -1.2735
203 G A -0.9683
204 P A -0.7526
205 G A -1.1531
206 A A -1.4047
207 T A -1.9411
208 A A -2.5574
209 E A -3.8699
210 R A -4.6920 mutated: IR210A
211 R A -5.3297 mutated: AR211A
212 R A -5.6570 mutated: AR212A
213 R A -5.6071 mutated: AR213A
214 R A -5.9980 mutated: LR214A
215 R A -5.5909 mutated: AR215A
216 A A -4.2251
217 R A -4.8865
218 Q A -4.1263
219 A A -3.2363
220 D A -3.9604
221 A A -3.3030
222 R A -4.3532 mutated: AR222A
223 R A -4.5768 mutated: YR223A
224 R A -4.9800 mutated: IR224A
225 R A -4.9384 mutated: PR225A
226 R A -4.7596 mutated: LR226A
227 R A -4.4829 mutated: PR227A
228 R A -4.3483 mutated: VR228A
229 D A -3.8721
230 R A -4.6810 mutated: WR230A
231 R A -5.1163
232 R A -5.4737 mutated: WR232A
233 R A -5.4297 mutated: AR233A
234 R A -5.4859 mutated: AR234A
235 R A -5.4468 mutated: YR235A
236 R A -5.2064 mutated: LR236A
237 R A -4.6506 mutated: PR237A
238 R A -4.8519 mutated: VR238A
239 D A -4.1692
240 R A -4.9704 mutated: WR240A
241 R A -4.6433
242 R A -5.2030 mutated: WR242A
243 R A -5.4894 mutated: PR243A
244 R A -5.2119 mutated: WR244A
245 R A -5.9158 mutated: AR245A
246 R A -6.1611 mutated: AR246A
247 R A -5.7635 mutated: YR247A
248 R A -5.8510 mutated: MR248A
249 R A -5.4625 mutated: AR249A
250 D A -4.8576
251 R A -5.8495
252 R A -6.0829 mutated: IR252A
253 R A -5.3681 mutated: VR253A
254 A A -4.8574
255 R A -5.2486
256 R A -4.3643 mutated: AR256A
257 R A -4.3298 mutated: AR257A
258 R A -4.0195 mutated: YR258A
259 R A -3.0053 mutated: LR259A
260 V A -0.3792
261 L A -0.6395
262 E A -1.4001
263 V A 0.9838
264 P A 0.5739
265 T A 0.3825
266 L A 0.9642
267 R A -0.7787
268 A A -0.0736
269 A A 0.6403
270 Y A 1.0878
271 S A 0.4553
272 V A 0.7177
273 D A -1.6397
274 G A -1.3853
275 R A -1.7032
276 P A -0.1712
277 V A 1.7746
278 F A 1.7041
279 K A -0.3131
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -3.6731 3.8418 View CSV PDB
4.5 -3.7434 3.5929 View CSV PDB
5.0 -3.8267 3.2466 View CSV PDB
5.5 -3.9069 3.2822 View CSV PDB
6.0 -3.9698 3.397 View CSV PDB
6.5 -4.0104 3.5773 View CSV PDB
7.0 -4.0348 3.7991 View CSV PDB
7.5 -4.0513 4.0386 View CSV PDB
8.0 -4.0632 4.284 View CSV PDB
8.5 -4.0688 4.5304 View CSV PDB
9.0 -4.0656 4.7738 View CSV PDB