Project name: 60ae48aaa6f36df

Status: done

Started: 2026-05-12 02:24:01
Chain sequence(s) A: MYSTDVVKENAYLSATRSGLESNEIATLQRSLPSRFNLRHLKKNESLKLVLQKKAGKSRVVAYKFTSGSFNYTAYRISDKKFYNLSDTSGKGSLDYPLPATARLSSPFNPARLNPVSGKVSPHNGIDYSMPMNTKIVSVIDGKITRAEYNSTMGYFVEVTGKAGVKTRYLHLNKILVTKGARVTRGDAIALSGNSGRSSGPHLHYELVINNNPVNSLAFRAAAPADNKLEQHAFAHARDYERYLD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:13)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:13)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:13)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:13)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:13)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:14)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:25)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/60ae48aaa6f36df/tmp/folded.pdb                (00:03:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:42)
Show buried residues

Minimal score value
-3.9514
Maximal score value
1.1136
Average score
-0.8923
Total score value
-218.6186

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.6200
2 Y A 0.3812
3 S A 0.1636
4 T A 0.0338
5 D A 0.1593
6 V A 0.4594
7 V A 0.0000
8 K A -3.2412
9 E A -3.6663
10 N A -2.1492
11 A A 0.0000
12 Y A -0.5517
13 L A 0.3956
14 S A 0.0000
15 A A 0.0000
16 T A -0.6666
17 R A -1.6401
18 S A -1.2223
19 G A -1.5770
20 L A 0.0000
21 E A -1.8658
22 S A -1.2186
23 N A -1.8763
24 E A 0.0000
25 I A 0.0000
26 A A -1.3586
27 T A 0.0000
28 L A 0.0000
29 Q A -1.8592
30 R A -2.4661
31 S A -1.3627
32 L A 0.0000
33 P A -1.2592
34 S A -1.7031
35 R A -2.2189
36 F A 0.0000
37 N A -2.9410
38 L A 0.0000
39 R A -2.6700
40 H A -3.3767
41 L A -3.4530
42 K A -3.9041
43 K A -3.9514
44 N A -3.2591
45 E A 0.0000
46 S A -1.9273
47 L A 0.0000
48 K A -0.4110
49 L A 0.0000
50 V A 0.0000
51 L A 0.0000
52 Q A -0.6747
53 K A -1.5671
54 K A -2.2621
55 A A -1.4591
56 G A -1.6697
57 K A -2.3606
58 S A 0.0000
59 R A -1.3358
60 V A 0.0000
61 V A 0.0000
62 A A 0.0000
63 Y A 0.0000
64 K A -0.6301
65 F A 0.0000
66 T A -0.7180
67 S A -1.0732
68 G A -1.0505
69 S A -0.4273
70 F A 0.1258
71 N A -0.4428
72 Y A -0.1796
73 T A -0.2908
74 A A 0.0000
75 Y A 0.0000
76 R A 0.0000
77 I A 0.0000
78 S A -1.8711
79 D A -2.9510
80 K A -3.1378
81 K A -1.8654
82 F A -0.6710
83 Y A 0.3235
84 N A -0.0256
85 L A 0.1431
86 S A -0.5525
87 D A -1.6164
88 T A -1.1113
89 S A -1.3308
90 G A -1.5952
91 K A -2.5043
92 G A -1.3985
93 S A -0.9852
94 L A 0.0000
95 D A 0.0000
96 Y A 0.0000
97 P A 0.0882
98 L A 0.5979
99 P A -0.1319
100 A A -0.0672
101 T A -0.3470
102 A A 0.0000
103 R A -1.4621
104 L A -0.2693
105 S A -0.5491
106 S A -0.4164
107 P A -0.4164
108 F A -0.6836
109 N A -1.1477
110 P A -0.8192
111 A A -0.6144
112 R A -1.0378
113 L A 0.1048
114 N A -0.4918
115 P A 0.0911
116 V A 1.1136
117 S A -0.1274
118 G A -0.8131
119 K A -1.4176
120 V A -0.4116
121 S A -0.6826
122 P A -0.8339
123 H A 0.0000
124 N A -1.1292
125 G A 0.0000
126 I A 0.0000
127 D A -0.5285
128 Y A 0.0000
129 S A -0.6769
130 M A 0.0000
131 P A -0.7383
132 M A -1.0423
133 N A -1.9575
134 T A -1.3381
135 K A -1.9540
136 I A 0.0000
137 V A -0.6619
138 S A 0.0000
139 V A 0.0000
140 I A 0.0000
141 D A -2.6758
142 G A 0.0000
143 K A -2.8600
144 I A 0.0000
145 T A -2.0012
146 R A -2.3459
147 A A -1.4313
148 E A -1.6723
149 Y A 0.2588
150 N A -0.6088
151 S A -0.6137
152 T A -0.8179
153 M A -0.5523
154 G A 0.0000
155 Y A 0.1502
156 F A 0.0000
157 V A 0.0000
158 E A 0.0000
159 V A 0.0000
160 T A -1.5558
161 G A -1.8914
162 K A -2.1663
163 A A -1.1366
164 G A -1.5189
165 V A 0.0000
166 K A -1.4922
167 T A 0.0000
168 R A -0.6035
169 Y A 0.0000
170 L A 0.0000
171 H A 0.0000
172 L A 0.0000
173 N A -1.1685
174 K A -1.2140
175 I A 0.4015
176 L A 1.0622
177 V A 0.0608
178 T A -1.2636
179 K A -2.8775
180 G A -1.9283
181 A A -1.9062
182 R A -2.8781
183 V A 0.0000
184 T A -1.7220
185 R A -1.5968
186 G A -1.4265
187 D A -1.7542
188 A A -0.4918
189 I A 0.0000
190 A A 0.0000
191 L A -0.9726
192 S A 0.0000
193 G A 0.0000
194 N A -1.6549
195 S A -1.1354
196 G A -1.2205
197 R A -2.3108
198 S A -1.5179
199 S A -0.9973
200 G A -0.9112
201 P A -0.9170
202 H A -0.9180
203 L A 0.0000
204 H A -0.4864
205 Y A 0.0000
206 E A 0.0000
207 L A 0.0000
208 V A 0.0000
209 I A 0.0000
210 N A -2.0365
211 N A -2.4060
212 N A -2.2657
213 P A -1.2901
214 V A -0.9077
215 N A -0.4785
216 S A 0.0000
217 L A -0.0191
218 A A -0.3968
219 F A -0.0742
220 R A -0.8343
221 A A -0.4901
222 A A -0.2208
223 A A -0.2249
224 P A -0.6749
225 A A -1.2689
226 D A -2.9886
227 N A -3.4830
228 K A -2.9662
229 L A -1.3669
230 E A -2.2841
231 Q A -2.6710
232 H A -2.3636
233 A A 0.0000
234 F A -1.2128
235 A A 0.0000
236 H A -1.5803
237 A A -0.8608
238 R A -1.4984
239 D A -1.5235
240 Y A 0.0000
241 E A -2.6404
242 R A -2.8983
243 Y A -1.3260
244 L A 0.0000
245 D A -2.5664
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.0441 2.1329 View CSV PDB
4.5 -1.0796 2.1329 View CSV PDB
5.0 -1.1192 2.1329 View CSV PDB
5.5 -1.1517 2.1329 View CSV PDB
6.0 -1.1644 2.1329 View CSV PDB
6.5 -1.1481 2.1329 View CSV PDB
7.0 -1.1059 2.1329 View CSV PDB
7.5 -1.0491 2.1329 View CSV PDB
8.0 -0.9855 2.1329 View CSV PDB
8.5 -0.9173 2.1329 View CSV PDB
9.0 -0.8439 2.1329 View CSV PDB