Project name: ok 6

Status: done

Started: 2026-03-17 06:55:45
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCSASSSVSYMNWYKQKPGLAPRLLIYDTSKLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:10)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:11)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:11)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:34)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/60cf9814b67398b/tmp/folded.pdb                (00:03:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:37)
Show buried residues

Minimal score value
-3.6797
Maximal score value
1.1456
Average score
-0.7482
Total score value
-178.8124

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7271
2 I A 0.0000
3 V A 1.0615
4 L A 0.0000
5 T A -0.2026
6 Q A 0.0000
7 S A -0.5378
8 P A -0.3540
9 A A -0.5031
10 T A -0.6090
11 L A -0.4837
12 S A -0.9422
13 L A -1.0870
14 S A -1.5567
15 P A -1.7749
16 G A -2.2742
17 E A -2.6599
18 R A -3.0464
19 A A 0.0000
20 T A -0.5567
21 L A 0.0000
22 S A -0.6414
23 C A 0.0000
24 S A -0.7598
25 A A 0.0000
26 S A -0.2681
27 S A -0.5579
28 S A -0.8018
29 V A 0.0000
30 S A -0.4911
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.6966
37 Q A 0.0000
38 K A -0.9100
39 P A -0.4326
40 G A -0.3659
41 L A -0.1311
42 A A -0.4808
43 P A 0.0000
44 R A -1.4750
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.4738
49 D A -1.0497
50 T A -0.8857
51 S A -1.1082
52 K A -1.5532
53 L A -0.6557
54 A A 0.0000
55 T A -0.3510
56 G A -0.6362
57 I A -0.6058
58 P A -0.9227
59 D A -1.8699
60 R A -1.8496
61 F A 0.0000
62 S A -0.8907
63 G A -0.6713
64 S A -1.0376
65 G A -1.1772
66 S A -1.0952
67 G A -1.0326
68 T A -1.3075
69 D A -2.1671
70 F A 0.0000
71 T A -0.7340
72 L A 0.0000
73 T A -0.8120
74 I A 0.0000
75 S A -2.3437
76 R A -3.2415
77 L A 0.0000
78 E A -2.0741
79 P A -1.5282
80 E A -2.2676
81 D A 0.0000
82 F A -0.8935
83 A A 0.0000
84 V A -0.6233
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0913
91 S A -0.3136
92 S A -1.1324
93 N A -1.7552
94 P A -1.6071
95 F A 0.0000
96 T A -0.1195
97 F A 0.0912
98 G A 0.0000
99 Q A -1.4915
100 G A 0.0000
101 T A 0.0000
102 K A -1.3655
103 L A 0.0000
104 E A -1.4956
105 I A -1.0326
106 K A -1.9576
107 G A -1.5516
108 G A -1.3933
109 G A -1.2857
110 G A -1.1525
111 S A -1.0012
112 G A -1.3872
113 G A -1.5956
114 G A -1.3688
115 G A -1.2885
116 S A -0.9261
117 G A -1.0996
118 G A -1.1128
119 G A -1.3286
120 G A -1.4102
121 S A -1.3589
122 Q A -1.7771
123 V A 0.0000
124 Q A -1.6440
125 L A 0.0000
126 V A -0.2231
127 Q A 0.0000
128 S A -0.7663
129 G A -0.7401
130 A A -0.2245
131 E A -0.4621
132 V A 0.7890
133 Q A -0.8697
134 K A -2.0573
135 P A -2.1295
136 G A -1.4818
137 A A -1.1654
138 S A -1.3181
139 V A 0.0000
140 K A -2.0976
141 V A 0.0000
142 S A -0.7659
143 C A 0.0000
144 K A -1.2981
145 A A 0.0000
146 S A -0.9325
147 G A -0.9322
148 Y A -0.7067
149 T A -0.7801
150 F A 0.0000
151 N A -2.1107
152 R A -2.3765
153 Y A -1.2307
154 T A -0.6096
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.2906
160 Q A -0.5585
161 A A -0.8940
162 P A -0.8364
163 G A -1.5399
164 Q A -1.8334
165 L A 0.0000
166 L A -0.4534
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.3652
171 I A 0.0000
172 N A -0.6021
173 P A 0.0000
174 S A -1.6616
175 R A -1.5166
176 G A -0.4072
177 Y A 1.0142
178 Y A 1.1456
179 N A -0.5618
180 Y A -1.4800
181 A A 0.0000
182 Q A -3.0404
183 K A -3.0374
184 F A 0.0000
185 K A -3.6797
186 D A -3.2558
187 R A -2.2355
188 V A 0.0000
189 T A -1.0126
190 M A 0.0000
191 T A -0.2183
192 R A -1.1468
193 D A -1.1472
194 T A -0.8460
195 S A -0.5550
196 T A -0.7237
197 S A -0.9492
198 T A 0.0000
199 V A 0.0000
200 Y A -0.8243
201 M A 0.0000
202 E A -1.4945
203 L A 0.0000
204 S A -1.2621
205 S A -1.2271
206 L A 0.0000
207 R A -2.8239
208 S A -2.2764
209 E A -2.4620
210 D A 0.0000
211 T A -0.9056
212 A A 0.0000
213 V A 0.0694
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1518
221 D A -2.4606
222 D A -2.4913
223 H A -1.5314
224 Y A -0.4050
225 C A 0.0000
226 L A 0.0000
227 D A -0.4307
228 Y A -0.4221
229 W A -0.4074
230 G A 0.0000
231 Q A -0.9821
232 G A -0.4026
233 T A 0.0000
234 T A -0.0906
235 V A 0.0000
236 T A -0.3689
237 V A 0.0000
238 S A -0.8106
239 S A -1.1263
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7617 1.9361 View CSV PDB
4.5 -0.8041 1.9388 View CSV PDB
5.0 -0.8539 1.946 View CSV PDB
5.5 -0.9016 1.9616 View CSV PDB
6.0 -0.9373 1.9869 View CSV PDB
6.5 -0.9545 2.0186 View CSV PDB
7.0 -0.9542 2.0531 View CSV PDB
7.5 -0.9424 2.0887 View CSV PDB
8.0 -0.9237 2.1244 View CSV PDB
8.5 -0.899 2.1597 View CSV PDB
9.0 -0.8679 2.1937 View CSV PDB