Project name: 611854fdcbcb0f9

Status: done

Started: 2026-03-24 06:16:11
Chain sequence(s) A: EVQLVESGGGLVKPGGSLKVSCAASGFSLSSYVLSWVRQTPEKRLEWVATINSLGAITYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARVSNFFFDVWGAGTTVTVSS
B: DIVMTQSHKFMSTSVGDRVSITCKASQDISNDVHWYQEKPGQCPKLLIYGASNRYSGVPDRLTGSGSGTDFTLTISNVESEDLADYFCQQSDFFPDTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:16)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:29:19)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:29:20)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:29:21)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:29:22)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:29:22)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:29:23)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:29:24)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:29:25)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:29:25)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:29:26)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:29:27)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:29:28)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:29:28)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:29:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:29:33)
Show buried residues

Minimal score value
-3.2136
Maximal score value
2.9652
Average score
-0.4757
Total score value
-106.5493

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8813
2 V A -0.9828
3 Q A -1.0725
4 L A 0.0000
5 V A 0.6788
6 E A -0.1438
7 S A -0.6453
8 G A -0.9765
9 G A -0.6703
10 G A -0.2829
11 L A 0.7753
12 V A 0.0000
13 K A -1.1554
14 P A -1.0507
15 G A -1.0703
16 G A -0.7215
17 S A -0.9144
18 L A 0.0000
19 K A -1.9070
20 V A 0.0000
21 S A -0.6202
22 C A 0.0000
23 A A -0.1355
24 A A 0.0000
25 S A -0.6211
26 G A -0.6445
27 F A -0.3300
28 S A -0.7354
29 L A 0.0000
30 S A -0.5171
31 S A -0.1937
32 Y A 0.4564
33 V A 0.7539
34 L A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.1269
38 R A 0.0000
39 Q A 0.0000
40 T A 0.0000
41 P A -1.3987
42 E A -1.8150
43 K A -2.9587
44 R A -2.9642
45 L A 0.0000
46 E A 0.0000
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.9395
51 I A 0.0000
52 N A 0.7427
53 S A 0.5692
54 L A 1.3317
55 G A 0.4568
56 A A 1.0572
57 I A 2.3053
58 T A 1.3620
59 Y A 1.8597
60 Y A 1.2993
61 P A 0.0497
62 D A -0.7534
63 S A -0.6926
64 V A -0.4659
65 K A 0.0000
66 G A -1.2462
67 R A -1.9608
68 F A 0.0000
69 T A -0.6345
70 I A 0.0000
71 S A -0.3245
72 R A -0.9530
73 D A -1.7301
74 N A -2.0357
75 A A -1.5094
76 K A -2.3285
77 N A -1.6174
78 T A -1.0189
79 L A 0.0000
80 Y A -0.5157
81 L A 0.0000
82 Q A -1.5310
83 M A 0.0000
84 S A 0.0000
85 S A -1.2413
86 L A -0.8748
87 R A 0.0000
88 S A -1.1173
89 E A -1.8120
90 D A 0.0000
91 T A -0.4798
92 A A 0.0000
93 M A -0.1540
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.2188
99 V A 0.0586
100 S A -0.2500
101 N A -0.8228
102 F A 0.4207
103 F A 0.0000
104 F A 0.0000
105 D A -0.5623
106 V A 0.0000
107 W A -0.0592
108 G A 0.0000
109 A A -0.0999
110 G A -0.5167
111 T A 0.0000
112 T A -0.1797
113 V A 0.0000
114 T A 0.1069
115 V A -0.0518
116 S A -0.4569
117 S A -0.7477
1 D B -1.5005
2 I B -0.1276
3 V B 0.6605
4 M B 0.1717
5 T B -0.4363
6 Q B 0.0000
7 S B -1.1097
8 H B -1.1599
9 K B -1.2462
10 F B 0.6820
11 M B 0.0306
12 S B -0.5479
13 T B 0.0000
14 S B -0.9448
15 V B -0.1590
16 G B -1.7346
17 D B -2.8254
18 R B -3.0753
19 V B 0.0000
20 S B -0.5788
21 I B 0.0000
22 T B -0.9145
23 C B 0.0000
24 K B -1.8285
25 A B 0.0000
26 S B -1.5033
27 Q B -2.2761
28 D B -2.4295
29 I B -1.1896
30 S B -0.7774
31 N B 0.0000
32 D B -1.0553
33 V B 0.0000
34 H B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 E B 0.0000
39 K B -1.7120
40 P B -1.5942
41 G B -1.1246
42 Q B -1.1239
43 C B -0.6061
44 P B -0.3928
45 K B -0.7762
46 L B -0.2501
47 L B 0.0000
48 I B 0.0000
49 Y B -0.6865
50 G B 0.0000
51 A B -0.7510
52 S B -1.2805
53 N B -2.1783
54 R B -2.3535
55 Y B -0.9593
56 S B -0.4488
57 G B -0.3232
58 V B 0.5633
59 P B -0.5524
60 D B -2.2102
61 R B -1.9509
62 L B 0.0000
63 T B -0.9291
64 G B -0.9852
65 S B -0.7606
66 G B 0.0000
67 S B -0.8915
68 G B -1.4642
69 T B 0.0000
70 D B -1.9964
71 F B 0.0000
72 T B -0.5756
73 L B 0.0000
74 T B -0.8122
75 I B 0.0000
76 S B -2.7811
77 N B -3.2136
78 V B 0.0000
79 E B -2.5211
80 S B 0.0000
81 E B -2.7553
82 D B -2.5606
83 L B 0.0000
84 A B 0.0000
85 D B -1.3300
86 Y B 0.0000
87 F B 0.0000
88 C B 0.0000
89 Q B 0.0000
90 Q B 0.0000
91 S B 0.9746
92 D B 0.8049
93 F B 2.8973
94 F B 2.9652
95 P B 1.2678
96 D B 0.8107
97 T B 0.0000
98 F B 0.0000
99 G B 0.0000
100 G B -1.4268
101 G B -1.4632
102 T B 0.0000
103 K B -0.8281
104 L B -0.8117
105 E B -0.3972
106 I B -0.3477
107 K B -0.8112
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.4757 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_11 -0.4757 View CSV PDB
model_0 -0.5148 View CSV PDB
model_1 -0.5169 View CSV PDB
model_5 -0.5239 View CSV PDB
input -0.5259 View CSV PDB
model_2 -0.5461 View CSV PDB
model_6 -0.5673 View CSV PDB
CABS_average -0.5758 View CSV PDB
model_7 -0.6002 View CSV PDB
model_4 -0.6024 View CSV PDB
model_10 -0.6118 View CSV PDB
model_3 -0.6243 View CSV PDB
model_8 -0.6616 View CSV PDB
model_9 -0.6645 View CSV PDB